KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111284Help
Entry
102111284         CDS       T02921                                 

Gene name
GBA2
Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102111284 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102111284 (GBA2)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102111284 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 843 aa AA seqDB search
MRRYEGAAKGRGVAADGWRVCLAHSFEELRQPYGAGDVPLRDVLRHIGLGLRYFRWWLKK
TCIEKKSAFIDLLCAVPLQQIYGCPLGGIGGGTITRGWRGEFCRWQLNPGLYQYETVIAN
QFTVCLRCKGQTIYQQVLSVERPSRLQGWNWGYCGHYAFYHALYPRAWLVYELPGQKVVL
TCRQLSPVIPHDYQDSSLPVGVFIWEVENGRDEDVEVSIMFSLQNGTGAEEDRSGGHWNE
PFTFQKDGERVAGVLLHHCPAVNSFTLAISAREKAGTGVTHVTAFNPMGLGREVWQDLLQ
DGRLDSPTGKSRPTEKGEVTAAAVCASCQVPAHGHKTLELALAWDMPCVHFGSKEKLHLR
RYTRFFGSKGDAAPALSHYALTHYKEWERKIEAWQNPILENSQLPSWYKSALFNELYFMT
DGGTIWMEVPPDCCAEDLQGPAGAGLSHLLPVLREYGRFAYLEGQEYRMYNTYDVHFYAS
FALIMLWPKLQISLQYDIAVTVVNEDVQPRQYLMCGQTAQVKMKNVVPHDIGDPGDEPWQ
RVNAYLMHDTADWKDLNLKFVLQVYRDYCLTHDSLYLQDMWPVCQAVMESELKFDTDNDG
LIENGGFADQTYDAWVVHGASAYCGGLWLAAVCMMCKMAEVLGDTEIQQKYLGILNKGKE
AFERMLWNGKYYNYDSSGSDTSSSIMSDQCAGQWFLGVCGLDHEVFPKNHILSALKTIFE
KNVLSFAGGTMGAVNGMRPDGVPDTSSVQSSEVWVGVVYSLAATMIQEGMVEEGFRTAEG
CYRTVWERLGMAFQTPEAYREKKVYRSLAYMRPLSIWSMQLALERRAGQALAPAQLCQGP
THP
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgctacgagggggcagcgaagggccgcggcgtggcggcggacggctggcgcgtc
tgcctggcacacagcttcgaggagctgcggcagccctacggcgccggggacgtgccgctc
cgtgatgtcctgcggcacatcggcctcggcttgcgatacttcaggtggtggctcaagaag
acctgcatagagaagaaatctgccttcattgacctcttgtgtgctgttcctctgcagcag
atctatgggtgtccgctgggtgggatcggaggaggcaccatcacccgtggctggcgggga
gagttctgccgctggcagctgaaccctggcctttaccagtacgaaacggtcattgccaat
cagttcacggtgtgcctgcggtgcaaggggcagacgatttaccagcaggtcttgtccgtg
gagagacccagcaggctgcagggctggaactggggctactgcggccactacgccttttac
catgcgctgtacccccgtgcctggctggtgtacgagctgccggggcagaaggtggtgctg
acttgccggcagctctctcccgtcatcccccatgactatcaggactccagcttgccagtg
ggagtgttcatctgggaggtggagaacgggagggatgaggacgtggaagtgtccatcatg
ttcagcctgcagaacggcacgggagcggaggaggacaggagcggcgggcactggaacgag
cccttcaccttccagaaggatggtgagcgggtggctggagtcctgctgcaccactgccca
gctgtgaactccttcaccctggccatttctgcccgggagaaggctggcacaggagtcacc
catgtcacggcattcaatcccatgggattgggcagagaggtgtggcaggacctcctgcag
gatggcaggctggattcacccaccggtaaaagcaggccaacagagaagggggaggtgaca
gcagcagcagtatgtgccagctgccaggtgcctgcccatgggcacaagacgctggagttg
gccctggcttgggacatgccctgtgttcactttggctccaaggagaagctgcacctcagg
cggtacacccggttttttggcagcaaaggcgatgctgcacctgccctgtcccattacgcc
ctgacacactacaaggagtgggagaggaagatcgaagcgtggcagaatcccatcctggag
aacagccagctgccttcctggtacaagtcagccctcttcaatgagctctacttcatgacg
gatggcggcaccatctggatggaggtgccccctgactgctgtgccgaggacctgcagggg
ccggcgggggcgggactgtcccacctcctccctgtcctgcgggaatacggaaggtttgct
tatttggaaggccaggagtaccgcatgtacaacacctacgatgtccatttctacgcctcc
ttcgctctcatcatgctgtggcccaagctgcagatcagcctgcagtatgacattgctgtc
actgtggtgaatgaggatgtccagccacgacagtacctgatgtgtggtcagacagcccag
gtgaagatgaagaatgtggtgccacatgacattggagacccaggtgatgagccatggcag
cgtgtcaatgcctacctgatgcacgacactgctgactggaaggacctcaacctgaagttt
gtgctgcaggtgtaccgtgactactgcctgacacatgactccctgtacctgcaggacatg
tggccagtatgccaggctgtgatggagtcagagctgaagtttgacacggataacgatggg
ctcattgaaaacggtggctttgctgaccagacatacgacgcgtgggtggtgcatggagcc
agtgcctactgcggcggactgtggctggctgctgtctgcatgatgtgcaagatggcagaa
gtgctcggggatactgagatccagcagaaatacctgggcatcctgaacaagggcaaggag
gcgtttgagaggatgctctggaatggaaaatactacaactatgatagcagtggaagtgac
acatccagcagcatcatgtcagaccagtgtgctgggcagtggtttcttggagtttgtggt
ctggaccatgaggttttccccaagaatcacattctcagcgcgctcaagaccatctttgag
aagaacgtgctgagctttgcgggtggcaccatgggggcagtgaacggcatgagacccgac
ggcgtgcccgacacctccagcgtccagtccagcgaggtgtgggttggcgtggtctactcc
ctggctgccaccatgatccaggagggcatggtggaggaaggcttccgtacggcagagggc
tgctacaggacggtttgggaacggctgggcatggctttccagacacccgaggcctatcgg
gagaagaaggtgtaccgctcgctggcctacatgcgtcccctcagcatctggagcatgcag
ctggccctggagcgccgggctggccaggcactggcacctgcacagctctgccagggcccc
acgcacccctga

DBGET integrated database retrieval system