KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111489Help
Entry
102111489         CDS       T02921                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102111489 (NCOA1)
Chromosome [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102111489 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1345 aa AA seqDB search
MSGLGDGSADPALPESRKRKGSPCDPGQSAEKRRREQEQRYLAELAELLSANLGDIDSLS
VKPDQCQILKKTVDQIQQMKRLEQEKSTDDDVQKSDVSSSSQGGVIEKESLGPLLLEALD
GFFFVVNREGRIVFVSENVSGYLGYAQEELMNSSVYSVLHVGDHAEFVRNLLPKSLVNGV
PWPQESPRRSSRSFQCRMLLRPPEEPGADGAEMRPRYEVMQCFTGCQPRRLQEEGEDFQS
CLICIARRLPRPAPQAPVESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQ
PQGREPSYAKQLFQEVMTRGAAFSPSYRFTLSDGSVLSAHTKCKLCYPSSPELQPFIMGI
HVIDRDHGILSPPEAPGLALPRLNPSVPSLPPSNGSGGFYWELDHGILSPPEAPGLALPR
LNPSVPSLPPSNGSAPHPANPGSGSFGNAPGSALSQSPGNSHPLSRGGSPMNSPGIPASQ
FLSPRHRGSPGAAPRSRGSAGNPFPPPSSSSSSSGGNSRPFPNSTLPDPSAFPRQPSSQN
SPGRLGGKNESKDGDPDKTADAGIPGILPGSDGNDAKCPPQATSQRLVQLLASTAEQQLR
HRGDPEIPKDSLGSGAGNCGGSSSSCPSSHSSLTERHKILHRLLQEGNPTDPAAGSNEEK
KENNGNAAPEKKESKDHQLLRYLLDKDEKESGAGISLDDVKVKMEKGENSEAVPKIPVGE
EGKAEPQGQFSAELEQLDQLLPSLEKPAPIPGICGPERNESGNSGVSGGTRAPAGIPELE
LGVAEAGLGIAGIAGIAEPVPWADPGTSALPRGALPKDEPCPLDELLCPPTTAEGRSDEK
ALLEQLVNFLSGKDETELAELDRALGIDKLVQGGGLEALTERFQPHQSTPSPLLLEQKPG
MFSQTFPPSSSSSSSSSSSSSSSASPSANIPGNFPGMLRQKAPPFGAVAVPPPPPPPPPP
PPARGTFPNNSMGIPARQPLSRPPSAPNQLRLQLQQRLQGQQQLIHQNRQALLNQFGSPV
GISMRPGMQQQLAPQPPLNAQMLAQRQRELYSQQHRQRQLMQQRALLMRQQNFGNSAAGI
PMGNPRLAQAPPQQFPYPPGYGTNAGNAGGSAFSGEAAALGNRGSLGNRGMMGAQFGAGA
GMGPAGIQQNLFQYSGSGMAQQSDGAFAPALSPGSPLMSPQLPPAPPAPGYQSPEVKSWN
NGVFGQAPAAPAAPAGMYNNMSITVSMGGSGGTGAVPSMAAMAGGIPMNSMMAGMNSMCS
EQVPDAALRPPGLFCNQLGSGELLKAEPDGAQVQQVQVFADVQCTVNLVGDPYLNPPAPL
ANPKNPAPPPPPGQGKSLLQQLLTE
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcctcggcgacggctccgcggatccggcccttcccgaatcccggaagcgcaaa
ggatccccctgcgaccccggccagagcgcggagaagcgccggcgggagcaggagcagcgg
tacctggcggagctggcggagctgctgtcggcgaacctcggcgacatcgactcgctcagc
gtcaaacccgaccagtgccagatcctgaaaaaaaccgtggatcagatccagcagatgaaa
cggctggagcaggagaaatccacggatgacgacgtccagaaatccgacgtctcctccagc
agccagggcggcgtcatcgagaaggaatccctggggccgctcctgctcgaggccctggac
ggatttttcttcgtggtgaaccgggagggccggatcgtgtttgtgtcggagaacgtgtcg
ggatatttgggatacgcgcaggaggagctgatgaactccagcgtttacagcgtcctgcac
gtgggagaccacgccgagttcgtccgaaacctcctccccaaatccctggtgaacggcgtt
ccgtggccgcaggagtctccgcgccgcagcagccgcagtttccagtgccggatgttgctg
cggccgccggaggagccgggagccgacggcgccgaaatgcgaccgcgctacgaggtcatg
cagtgcttcaccggctgccagccacggaggctccaggaggagggggaagatttccagtcg
tgtctgatctgcatcgcccggaggctgccgcgcccggccccccaagccccggtcgagtcc
ttcgtcaccaaacaggacaccacgggaaaaatcatctccatcgacaccagctccctgcgc
gccgccggccggacgggctgggaggatctggtccggaaatgcatctacgccttcttccag
ccccagggccgcgagccctcctacgccaagcagctcttccaggaagtgatgacgcggggc
gcggccttcagcccctcgtaccgcttcacgctgagcgacggctcggtgctgagcgcccac
accaagtgcaagctctgctacccctcgagcccggagctgcagcccttcatcatgggcatc
cacgtcatcgacagggatcacggaattctgtctccgccggaggctcccggcctggccctg
ccgcgcctgaatcccagcgttccttccctccctccatccaacggctccgggggattttat
tgggaattggatcacggaattctgtctccgccggaggctcccggcctggccctgccgcgc
ctgaatcccagcgttccttccctccctccatccaacggctccgctcctcatcccgccaat
cccggctccgggagtttcgggaacgctccgggatccgccttaagccaaagccccgggaat
tcccaccctttatcccgcggcggctcccccatgaacagccccggaattccggcgtcgcaa
ttcctgtccccccggcaccgcggcagccccggagccgctcccaggtcccgcgggtccgcc
gggaatcctttcccgcctccttcctcctcctcctcctcgtccggcggcaattcccggcct
tttcccaactccacgcttcccgatccatcggcgttcccgcggcaacccagctcccaaaac
tctccgggacgtttgggcgggaagaacgaatccaaggacggcgatcccgacaaaacggcc
gacgccggaattccgggaattctcccgggatcggacgggaacgatgccaagtgtcctccc
caagccaccagccagcggctggtgcagctcctggccagcacggccgagcagcagctgcgg
caccgcggcgatcccgaaattcccaaggattctttgggatcgggagcggggaattgcggc
ggttcctcgtcgtcgtgtccgtcgtcgcacagctcgctgacggagcgccacaaaatcctg
caccggctgctccaggagggaaatcccacggatcctgcggcggggagtaacgaggagaag
aaggagaacaacgggaacgcggcgccggagaaaaaggaatccaaggatcatcagctgctc
cggtacctcctggataaggacgagaaggagtcgggagccgggatcagcctggacgacgtc
aaggtcaagatggaaaagggggaaaattccgaggccgttcccaaaattcccgtgggagaa
gagggaaaggcggagccgcaggggcagttctcggccgagctggagcagctggatcagctc
ctgccttccttggaaaaaccggcgccgattcccgggatttgcggcccggaaaggaacgaa
tccggaaattccggagtgtccggagggaccagagcccccgcgggaattccggagctggag
ctgggcgtggccgaggccggtttgggaatcgcggggatcgcggggatcgcggagccggtg
ccgtgggcggatccgggaacgtcggcgctgccccgcggggccctgcccaaggacgagccg
tgccccctggacgagctgctgtgcccgcccaccacggccgagggccgcagcgacgagaag
gcgctgctggagcagttggtcaatttcctgagcgggaaggacgagacggagctggcggag
ctcgaccgcgccctcggcatcgacaaactcgtccagggcggcggcctggaagcgttgacg
gagcgattccaaccccaccaatccacgccctccccgctgctcctggagcaaaaaccggga
atgttctcccaaactttcccaccttcctcatcctcctcatcctcctcctcctcctcctcc
tcctcctcggcctctccgagcgccaacattcctgggaatttcccgggaatgctccggcag
aaagcgccgcccttcggagccgtcgccgtccctcctcctcctcctcctcctcctcctcct
cctcccgcccgtggaacattcccgaataattccatgggaattccggcccggcagcctctg
agccgccctcccagcgctcccaaccagctccgcctgcagctccagcagcgcctccagggc
cagcagcagctgatccatcagaaccgccaggcgctcctcaaccagtttggatctcccgtg
gggatctccatgaggccggggatgcagcagcagctggcgccgcagccgccgctgaacgct
cagatgttggcgcagcggcagcgcgagctctacagccaacagcaccggcagcggcagctg
atgcagcaacgcgccctcctcatgcggcagcagaatttcgggaattccgccgccggaatt
cccatgggaaacccgaggttggctcaagccccgccccagcagttcccgtatccccccggt
tacggtacgaacgccgggaatgccggcggatccgcgttctccggagaggcggcggcgttg
gggaatcgtggatcgctggggaatcgcgggatgatgggagcgcagttcggagccggagcc
gggatgggcccggcggggatccagcagaatttgttccaatattcgggatcagggatggcg
cagcagagcgacggcgccttcgcgcccgcgctgagccccggcagccccctgatgtcaccg
cagctgccgccggcgccgcccgcgcccggataccaatcgccggaagtgaaatcatggaat
aacggggtgttcgggcaggctccggcggctccggcggctccggcgggaatgtacaacaac
atgagcatcaccgtgtccatgggcggctccggcggcaccggcgccgttcccagcatggca
gccatggccggcggaattcccatgaattccatgatggccgggatgaattccatgtgctcc
gagcaggtcccggacgcggcgctgagacctccagggctcttctgtaaccagctgggctcc
ggggagctgctcaaggccgagcccgacggcgcccaggtccagcaggtccaggtgttcgcc
gacgtccagtgcacggtgaatttggtgggagatccctacctcaacccgccggctccgttg
gccaatcccaaaaatcccgctccgccgcctccgccgggacaagggaagagcctcctgcag
cagctgctgacggaataa

DBGET integrated database retrieval system