KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111563Help
Entry
102111563         CDS       T02921                                 

Gene name
KAT2B
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102111563 (KAT2B)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102111563 (KAT2B)
Transcription machinery [BR:phi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102111563 (KAT2B)
Chromosome [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102111563 (KAT2B)
   HAT complexes
    PCAF complex
     102111563 (KAT2B)
    STAGA complex
     102111563 (KAT2B)
    TFTC complex
     102111563 (KAT2B)
    SAGA complex
     102111563 (KAT2B)
    SLIK complex
     102111563 (KAT2B)
    ADA-HAT complex
     102111563 (KAT2B)
    HAT-A2 complex
     102111563 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 799 aa AA seqDB search
MAEPGGGGGGAGAAGGPQQGSPAAAGPVRSAAESPGGPGSARTAGKKAQLRAAPRAKKLE
KLGVYSACKAEESCKCNGWKNPNPPATPPRAELQQAAVSLAEPCRSCSHALAAHVSHLEN
VSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLES
PPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRSPND
DIAGYKVNYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDK
LPQEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFMVSSSQTGQLGIQTVISPPPVARS
VAYSASPSSLEQSNSGNMSPACKISSALDPNLGEKRKNNEPYSLEDSKRPRVVGDIPIEL
INEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMM
WLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVF
CAVTSNEQVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKY
VGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKD
GVRQIPIESIPGIRETGWKPSGKERGKEAKDPDQLYSTLKTILQQVKSHQSAWPFMEPVK
RTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYYKCA
NILEKFFYTKIKEAGLIDK
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcctggcggcggcggtggcggggccggggcggcgggcgggccgcagcagggc
tccccggccgccgcggggccggtccgcagcgccgccgagagccccggggggcccggctcg
gcgcgcaccgcggggaagaaggcgcagctgcgcgccgcgccgcgggccaagaagctggag
aagctgggcgtctactccgcttgcaaggccgaggagtcctgtaaatgcaatggctggaag
aacccgaacccgcctgccacgccgccgcgggccgagctgcagcaggcagcggtcagcctg
gccgagccctgccgcagctgcagccacgccctggctgctcatgtttctcacctggagaat
gtgtctgaagaagaaatgaacaggctcctggggattgtgttggatgtggaatatctgttc
acctgtgtccacaaagaagaagatgcagacaccaagcaagtttatttctacctgttcaaa
cttttgaggaagtgcattttgcagatgggaaaacctgtagtagaaggatctttggaaagt
cccccatttgagaaacctagcattgaacagggtgtgaataattttgtgcagtacaaattt
agccacttaccctcgaaggaaaggcaaacaatagtggagctggctaaaatgtttctgaac
cgcatcaactactggcacctggagacaccttctcagcgaagactaagatcacccaatgat
gatattgcggggtataaagtgaattataccaggtggctttgttactgcaatgtccctcag
ttttgtgacagtctacctcggtatgaaaccacccaggtttttggtaggacattgcttcgc
tctgtttttactgtaatgagacgacaactgctggagcaggccaggcaagaaaaagacaag
cttcctcaagaaaaacgaacactaatcctcactcattttccaaagtttctgtctatgctg
gaagaagaagtgtacagccagaattctcccatttgggatcaggatttcatggtgtctagt
tcccaaactggccagctgggaatccagacagttatcagtccacctcctgttgcaagatct
gttgcatacagtgcaagtccttcatctctggagcaatccaacagtgggaatatgagtcca
gcttgtaaaatttcttctgcccttgacccaaacttaggggaaaagagaaaaaataatgag
ccctattctctggaggattctaaaagaccaagggttgtaggagatatccctattgagtta
atcaacgaagtaatgtcaacaattacagatcctgcagcaatgcttgggccagagaccaac
ttcctctcggcacactcagcccgggacgaggcagcgaggctggaggagcgcaggggcgtg
attgaattccatgtggttggcaactccctgaaccagaagcccaacaagaagatcatgatg
tggctggttggtttgcagaatgtgttctcccatcagctgcctcgaatgccgaaggaatac
atcacccgcttggtctttgatccgaaacataaaacccttgcattaataaaagatggtcgt
gttatcggtggtatctgcttccggatgttcccctcccaaggatttacagagattgttttc
tgtgctgtgacttccaatgagcaagtcaagggttatgggactcacctaatgaaccatctg
aaggagtaccacatcaaacacaacattctcaactttctcacgtatgcagatgaatatgct
attggctacttcaagaaacaaggtttctccaaagatattaaagtaccaaaagcaaaatat
gttggctacatcaaggattatgagggtgccacattaatgggatgtgaattaaatccaagg
atcccctacaccgaattttctgtcatcatcaaaaagcaaaaagagatcattaaaaagctc
atagaaaggaagcaagctcaaataagaaaagtttatcctggcctttcttgcttcaaagat
ggagtacggcagattcctatagaaagcattcctggaattagagagactggctggaaacca
agtggaaaagaaagaggtaaggaggccaaggatccagatcaactttacagcacattaaaa
accatcctgcagcaagtgaagagccatcaaagcgcttggcccttcatggaacccgtgaag
agaacagaagctcctggatattatgaagttataaggtttcccatggatctcaaaacaatg
agtgagcgactcaagaacaggtactacgtgtctaagaaattattcatggcagacttgcag
cgagtctttacaaactgcagagagtacaacccccccgagagtgaatactacaaatgtgcc
aatatactggagaaattcttctacacaaaaattaaagaagctggattaattgacaagtga

DBGET integrated database retrieval system