KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111905Help
Entry
102111905         CDS       T02921                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102111905
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102111905
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102111905
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102111905
  Exosomal proteins of breast milk
   102111905
Heparan sulfate/heparin binding proteins [BR:phi00536]
 Enzymes (General comment) Variety
  102111905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 487 aa AA seqDB search
MWRKAFLAAVCLCLRWVAALGGEQAEGENDFEGIESKFSLRTPAEPDEDVCYLVPGQVNS
LAQCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQQHYPV
SAAYTRLVGKDVATFIDWLEEKFNYPLNNLHLLGYSLGAHAAGIAGNLTKKKVNRITGLD
PAGPTFEYADELTRLSPDDAEFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGC
NLGEALRLIAEKGFGDVDQLVKCSHERSIHLFIDSLLNEEKPSMAYRCNTKEAFEKGLCL
SCRKNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNMTKTNQPFR
ISLYGKLDESENIAFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSDWWTP
FTFDIQRIRVKSGETQKKVVFCSRDGTSRLSKGEEAAIFVKCSEQPVNRKRGGTKKASKE
NSAHESA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggaaggcgttcctggccgccgtgtgcctctgcctgcgttgggtggctgctctc
ggcggtgagcaagcagaaggtgaaaacgattttgagggcatcgagagcaagttttcttta
cggacgcctgcagagcctgatgaggatgtctgctatcttgttcctgggcaggtgaacagc
ctggcacagtgcaacttcaatcataccagtaaaacctttgtggtgatccatgggtggacg
gtgacagggatgtatgaaagttgggtcccgaagctggtggatgctctgtacaagagggag
cctgactcaaacgtcattgtggtggactggctggttcgagctcagcagcactatccagtg
tctgctgcatacaccaggctggtgggaaaggatgttgctacatttattgactggttggag
gagaaattcaattatcctctcaacaatctccacttgctggggtacagcctaggtgcccat
gctgctgggattgctgggaacctgaccaaaaagaaggtgaacagaattactgggctggat
cctgctggtcctacctttgagtatgcggatgaactgacccgcctctccccggatgatgct
gagtttgtggatgtcctacacacttacaccagaggctctccagaccgcagcattgggatc
cagaagcctgttggacacattgatatttatcccaatggtggaggtttccagccaggttgc
aatctgggagaagcactgcgtctgattgctgagaaaggctttggagatgtggatcagctg
gtgaaatgctcccatgaacgatccatccacctcttcattgactctctcctcaatgaagaa
aagcccagcatggcctatcgctgtaacacaaaggaggcctttgagaagggcctgtgcctg
agctgccgcaagaaccgctgcaacaatttgggttacaaggtcaacagagtgagaacaaag
agaaacaccaaaatgtatctgaaaacccgtgctcagatgccctataaagtctttcattac
caagtcaagatccatttctttggaaagactaacatgaccaagacaaaccagccattccgg
atctctctctatggcaagctagatgaaagtgagaacattgctttcacactgcctgaagtc
tcctcaaacaagaccttctccttcctgatttacacagaagtagatattggagacctgctt
atgctgaagctgcagtgggaaaaggacaccttcttcagctggtcagactggtggactcct
tttacgtttgacatccagagaatcagagtgaagtcaggagaaactcagaaaaaagtggtg
ttctgttctcgagatggcacctcacgtctcagtaaaggagaagaggcagcaatatttgtg
aaatgctcagagcagcccgtcaacaggaagagaggaggtaccaagaaagcctcaaaagaa
aattctgctcatgaatctgcttaa

DBGET integrated database retrieval system