KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112793Help
Entry
102112793         CDS       T02921                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:phi00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102112793 (CLOCK)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102112793 (CLOCK)
Transcription factors [BR:phi03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102112793 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 856 aa AA seqDB search
MFFTISTHKMSSIADRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGNIIYVSESITPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEQPTYEYVKFIGNFKCLNHVPNSAHNGFEGTIQRS
HRPSYEEKVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEITADKSQDSGSDNHINTVSLKEA
LERFDTSPTPSASSRSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQGLSGHEKTAQRRSSL
SSQSLSSQSLGQPVTQPAISQPATLQLQSGMTQPVFQFSAQLGAMQHLKDQLEQRTRMIE
ANIHRQQEELRKIQEQLQIVHGQGLQMFLQQSASGLNFGSVQLPSGNSSTVQQLTPINMQ
GQVVQTNQTQSGMNTGHINTPHMIQQQQPLQSTATQHNQQNVLSGHNQQSSLASQSQNTV
SAPLYNTMVISQPTAGNVVQVPSSLSQNNNQNAAAVTTFTQDRQIRFSQGQQLVTKLVTA
PVACGAVMVPSTMFMGQVVTAYPTFAAQQQQTQTLSITQQQQQQQQQQQSQQDHQQQLTT
VQQPAQSQLTQHPQQFLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQSQQQQLS
RHRTDKMTDPSKVQPQ
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaccataagcacccataaaatgagctccattgcagacagaaatgacggaagc
atttttgatgggctggtggaagaagatgacaaagataaagcaaaaagagtgtctagaaac
aagtctgaaaagaaacgtcgagatcagtttaatgtgcttatcaaagagttgggttccatg
cttccaggtaatgctcggaagatggacaaatccactgtgctgcagaagagcattgacttt
ttacggaagcacaaagaaattactgcacaatcagatgccagtgaaattcgtcaggactgg
aaaccgacattccttagtaacgaagagttcacacagttaatgttagaggctcttgatggt
ttttttttagcaattatgacagatggaaatataatatatgtgtctgaaagtataactccc
ttacttgaacatttgccatctgatcttgtggatcagagtgtatttaattttatcccagag
ggggaacattcagaaatttataaaatattgtcttctcatctgctggaaagtgattccttg
acaccggaatacttaaaatcaaaaaatcagctagaattctgttgccatatgctgcgagga
acaatagatccaaaagagcaacctacatatgaatatgtaaaatttataggaaatttcaaa
tgtttgaatcatgttcccaactcagcgcacaatggttttgaaggaactattcagagatca
caccggccttcatatgaagagaaagtttgctttgtagccacagttagattagctacacct
caatttatcaaggaaatgtgcactgttgaagaacccaatgaagagttcacatctaggcac
agcttagaatggaagttcctattcttggatcacagggcacctcccataataggttatctt
ccatttgaagttttgggaacatcaggctatgattactatcatgtggatgatctagataat
ctggcaaaatgtcatgagcatttaatgcaatatgggaaagggaagtcatgttactacaga
ttccttacaaagggacaacagtggatttggctgcaaactcattactatatcacgtatcac
cagtggaattccaggccagagtttattgtctgtacgcacactgttgtaagttatgcagaa
gttagagcagaaagacgacgagaacttggtattgaggaatctcttccagagataacagca
gataagagtcaggactctgggtctgacaatcacataaacacagtgagtctcaaagaagca
ctggaaaggtttgataccagccccacaccttctgcttcctccaggagttcaagaaaatct
tcacatactgcagtgtcggatcattcatcaacaccaactaaaatgacagtggacactagc
actcctccaaggcaaggcttatctggtcatgaaaagactgcgcaaagaagatcatctctg
agcagtcagtctttaagctcacagtctcttggacaaccagtaacacagccagcaatatct
cagcctgcaactttgcagctccagtctggaatgactcagcctgtgtttcagttttcagct
cagctaggagctatgcaacatcttaaggaccagctagagcaaagaacacgcatgatagag
gcaaatattcatcggcagcaggaagaattgcgtaagattcaagagcagcttcaaattgtt
catggtcaaggactccagatgttcttgcagcagtcagcttctggactcaactttggttct
gtgcagcttccttctggaaattcttcaactgttcagcagcttacaccaataaacatgcaa
ggtcaagttgttcagactaatcagactcaaagtgggatgaacacaggccatataaatact
ccacacatgatacagcagcagcagcctttgcagagtactgcaacacagcataatcaacaa
aatgtgcttagtggacacaatcagcagtcttctcttgccagccagtcacagaacacagtc
tcggcacctttgtacaacactatggtgatttctcagccaacagcaggaaatgtggtgcag
gttccctctagtttatcacagaacaacaaccagaatgctgctgcagtaaccacttttaca
caggacagacaaatcagattttctcaaggtcagcaacttgtaacaaaacttgtcacggcc
ccagtagcatgtggagcggtaatggtaccaagtactatgttcatgggacaggtggtgaca
gcttatcccacttttgctgcccaacagcagcagacacagactttgtcaataacacaacaa
cagcagcagcagcagcagcaacagcaaagtcagcaggaccatcagcagcagctcaccaca
gtacaacagccagctcagtcacagctgacccagcaccctcagcagttcctacagacatcc
aggttacttcatggaaatcagtcggctcagcttattctatctgctgctttcccactacaa
caaagcactttcactcagtcccaccaccagcagcatcagtctcagcagcagcagctgtca
cgacacagaactgacaagatgactgatccttccaaagttcagccacagtag

DBGET integrated database retrieval system