KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113709Help
Entry
102113709         CDS       T02921                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102113709
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102113709
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102113709
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102113709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 486 aa AA seqDB search
MVCVCNATYCDTLDPLALPDPGSYVKYESSKAGKRLERSEGRFQRRLCAPDVVLTLDTTQ
RFQRVKGFGGSITDAAAINILSLPERAQDHLLRSYFSEEGLEYNLIRLPMASCDFSLHAY
TYDDVPYDYELTHFSLRDEDTKLKIPLLHRASAMSKRPLSLYASPWTSPTWLKTSESYVG
KGTLKGQAGDRYHKTWANYFVRFLDEYAKHNVTFWAVTAENEPTAGLINNYPFQCLGFTA
EQQRDFIARDLGPALANSSHRHVQLIILDDNRLHLPHWARVVLEDEGAARYVHGIGIHWY
LDFIGPIQDTVLPTHELFPDYFILATEACIGAHFWERDVILGCWERGNQYSHSILMNLNH
FVAGWTDWNLALDLEGGPNWVKNYVDSPIIVDSSEGIFYKQPMFYHMGHFSKFIPEGSQR
VGLVASRESKKTALEYAAFLRPDGAVVVVLLNRSPQDIALGLADTVGLIAAVAPANSIQT
YLWRRQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtctgcgtctgcaatgccacgtactgtgacactctggatcccctggccctgccggac
cccggctcctatgtcaagtatgagagcagcaaggccggcaagcggctggagcggagcgag
gggaggttccagcgcagactctgcgccccagatgtcgtcctcaccctggacacgacgcag
cggttccagagggtgaagggttttggtggctccatcacggacgcggccgccatcaacatc
ttatccctgccagaaagagcacaggatcacctgctgcgctcgtacttctctgaggagggg
ctggagtacaacctcatccgcctgcccatggccagctgcgacttctccctccacgcctac
acctacgatgatgtcccctacgattacgagctcacccacttcagcctgcgagatgaggac
acgaagctgaagatccccctccttcaccgagcctcggccatgagcaagcggccgctgtca
ctgtatgccagcccctggacctcccccacctggctgaagaccagcgagtcctatgtgggg
aaggggacactgaaggggcaggcaggggacaggtaccacaagacctgggccaactacttt
gtacggttcctagatgaatatgccaagcacaacgtgacattctgggcagtgacagcagag
aacgagcccacggctgggctgatcaacaattaccccttccagtgcctgggcttcacagcc
gagcagcagcgggacttcatcgctcgggacctgggcccggcgctggccaacagctcccac
cgccacgtccagctcatcatcctggacgacaaccggctccacctccctcactgggccaga
gtggtcctggaggatgagggggcagctcgctacgtccacggcatcggcatccactggtac
ctggacttcatcggtcccatacaggacacagtgttgcccactcatgagctcttccctgac
tactttatcctggccacggaggcgtgcattggtgcccatttctgggagcgggatgtgatc
ctgggctgctgggagcggggaaaccagtacagccacagcatcctgatgaatctgaaccac
tttgtggccggctggactgactggaatctggccctggatctggaggggggccccaactgg
gtcaagaactacgtggacagccccatcattgtggacagcagcgaaggcatcttctacaag
cagcccatgttctaccacatggggcacttcagcaaattcatccccgagggctcccagcgt
gtggggctcgtcgcctccagggagtccaagaaaacagcgctggagtacgcggctttcctg
cgccctgacggggctgtggtcgtggtgcttctgaaccgatccccacaggacatcgccttg
gggctggcggacaccgtcggcctcatcgcggccgtggctccggccaactccatccagacc
tacctgtggcggcggcagtga

DBGET integrated database retrieval system