KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114339Help
Entry
102114339         CDS       T02921                                 

Gene name
UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102114339 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    102114339 (UGT2A1)
   00500 Starch and sucrose metabolism
    102114339 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102114339 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102114339 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    102114339 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102114339 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    102114339 (UGT2A1)
   00983 Drug metabolism - other enzymes
    102114339 (UGT2A1)
Enzymes [BR:phi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102114339 (UGT2A1)
Glycosyltransferases [BR:phi01003]
 Others
  Hydrophobic molecule
   102114339 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
MAMKTTGSKKYLQLLLFQVALLGPVFCGKILVWPTEGSHWMNMNVIIQELIRRGHSFTIL
VSNATLYIEPRPKATEKFETYYVPFKKDVPENLINGIVDLWLNNRPTILTFWQFYKELGR
LSVGWQEMNKMMCDAVLTNQELMARLQGSGFDLMLSDPVTPCGELVAVKLGIPFVYSLRF
SPAFTLERHCGKIPTPPSYTPAALSELTDHMSFGERVKNFVSYHLQDYVFQSYWGHWDIY
YSKALGRPTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCQPAKPLPKEMEEF
VQSSGEHGVIVFTLGSMVHNLSDERSNVIAKALSQLPQKVLWRYKGKKPETLGSNTRIYG
WIPQNDLLGHPLTKAFITHGGTNGLYEAIYHGIPMVGIPMFADQHDNIAHMVAKGAAVQV
DFNTMKTQDLVDALNTVIYNSTYKENALKLSQIQHDQPVKPLDRAVFWIEFVMRHKGAKH
LRPAAHHLTWYQYHSLDVLAFLFTCTATIVLILFKCCLCCCRRCGRIAKRKKE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaaaacaacaggttcaaagaaatacctccagctgctactttttcaggttgcc
ctgctagggcctgtcttctgtgggaagatactggtttggccaacggaaggtagccactgg
atgaacatgaatgtaattatacaggagctcatccgccgtgggcacagctttaccatcctg
gtatccaacgctaccctctacattgaacccaggcctaaggccacggagaagtttgagacc
tattatgtgcccttcaagaaagatgttcctgagaacctgattaatggaatagtggatctg
tggctcaacaacaggccaactattttgaccttctggcagttttacaaggagctgggaaga
ctgtccgtaggctggcaggagatgaacaagatgatgtgtgatgcagtgctgaccaaccaa
gagctgatggctcgtctgcaggggtctggctttgacctgatgctgtcagaccctgtgacc
ccctgtggggaactcgtggctgtcaagctgggcattccctttgtctactcactacgtttc
tccccagccttcacgctggaaaggcactgtggcaagatcccaaccccaccatcctacacg
cctgcagccctgtctgagctcactgaccacatgtcttttggggagagagtaaaaaacttt
gtgtcttaccacctgcaagactacgttttccagagctactggggacattgggatatctac
tacagcaaggccttaggaaggcccacaaccctgtgtgagacgatggggaaagcagagatt
tggttaatcagaacatactgggattttgaatttccacgccctttcctgcccaactttgag
tttgttggaggacttcattgccagcctgcaaaaccattaccaaaggaaatggaagaattt
gttcagagctcaggggaacatggtgtcattgtattcactcttgggtcgatggtccacaac
ctaagtgatgaaagaagtaatgtgattgccaaagccctcagccagcttccacaaaaggtc
ctctggcggtacaaagggaaaaaaccagaaactctgggctccaacaccaggatttatggc
tggataccacaaaatgacctgcttggccatcccttgactaaggcctttatcacacatggt
gggaccaatgggctctatgaagccatctaccacgggatcccaatggttgggattcccatg
tttgctgaccagcacgacaacattgctcacatggtagcaaaaggagctgcagttcaggtg
gatttcaacacaatgaagacccaggacctggttgatgcactgaacacagtcatttacaat
tccacctataaggaaaacgctctaaagttatcccagatacagcacgaccagcctgttaag
cctctggacagagctgtcttctggattgaatttgtcatgcgtcacaaaggagcaaagcac
ttgagaccagctgctcaccatctcacttggtaccagtaccacagcctggatgttctggca
ttcttgttcacctgtacagccactattgtcctcattcttttcaagtgctgcctatgttgc
tgtagaagatgtggcaggattgcaaagaggaagaaggaatag

DBGET integrated database retrieval system