KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114339Help
Entry
102114339         CDS       T02921                                 

Gene name
UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:phi00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:phi00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:phi00500]
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:phi00140]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:phi00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:phi00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:phi00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:phi00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:phi00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
MAMKTTGSKKYLQLLLFQVALLGPVFCGKILVWPTEGSHWMNMNVIIQELIRRGHSFTIL
VSNATLYIEPRPKATEKFETYYVPFKKDVPENLINGIVDLWLNNRPTILTFWQFYKELGR
LSVGWQEMNKMMCDAVLTNQELMARLQGSGFDLMLSDPVTPCGELVAVKLGIPFVYSLRF
SPAFTLERHCGKIPTPPSYTPAALSELTDHMSFGERVKNFVSYHLQDYVFQSYWGHWDIY
YSKALGRPTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCQPAKPLPKEMEEF
VQSSGEHGVIVFTLGSMVHNLSDERSNVIAKALSQLPQKVLWRYKGKKPETLGSNTRIYG
WIPQNDLLGHPLTKAFITHGGTNGLYEAIYHGIPMVGIPMFADQHDNIAHMVAKGAAVQV
DFNTMKTQDLVDALNTVIYNSTYKENALKLSQIQHDQPVKPLDRAVFWIEFVMRHKGAKH
LRPAAHHLTWYQYHSLDVLAFLFTCTATIVLILFKCCLCCCRRCGRIAKRKKE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaaaacaacaggttcaaagaaatacctccagctgctactttttcaggttgcc
ctgctagggcctgtcttctgtgggaagatactggtttggccaacggaaggtagccactgg
atgaacatgaatgtaattatacaggagctcatccgccgtgggcacagctttaccatcctg
gtatccaacgctaccctctacattgaacccaggcctaaggccacggagaagtttgagacc
tattatgtgcccttcaagaaagatgttcctgagaacctgattaatggaatagtggatctg
tggctcaacaacaggccaactattttgaccttctggcagttttacaaggagctgggaaga
ctgtccgtaggctggcaggagatgaacaagatgatgtgtgatgcagtgctgaccaaccaa
gagctgatggctcgtctgcaggggtctggctttgacctgatgctgtcagaccctgtgacc
ccctgtggggaactcgtggctgtcaagctgggcattccctttgtctactcactacgtttc
tccccagccttcacgctggaaaggcactgtggcaagatcccaaccccaccatcctacacg
cctgcagccctgtctgagctcactgaccacatgtcttttggggagagagtaaaaaacttt
gtgtcttaccacctgcaagactacgttttccagagctactggggacattgggatatctac
tacagcaaggccttaggaaggcccacaaccctgtgtgagacgatggggaaagcagagatt
tggttaatcagaacatactgggattttgaatttccacgccctttcctgcccaactttgag
tttgttggaggacttcattgccagcctgcaaaaccattaccaaaggaaatggaagaattt
gttcagagctcaggggaacatggtgtcattgtattcactcttgggtcgatggtccacaac
ctaagtgatgaaagaagtaatgtgattgccaaagccctcagccagcttccacaaaaggtc
ctctggcggtacaaagggaaaaaaccagaaactctgggctccaacaccaggatttatggc
tggataccacaaaatgacctgcttggccatcccttgactaaggcctttatcacacatggt
gggaccaatgggctctatgaagccatctaccacgggatcccaatggttgggattcccatg
tttgctgaccagcacgacaacattgctcacatggtagcaaaaggagctgcagttcaggtg
gatttcaacacaatgaagacccaggacctggttgatgcactgaacacagtcatttacaat
tccacctataaggaaaacgctctaaagttatcccagatacagcacgaccagcctgttaag
cctctggacagagctgtcttctggattgaatttgtcatgcgtcacaaaggagcaaagcac
ttgagaccagctgctcaccatctcacttggtaccagtaccacagcctggatgttctggca
ttcttgttcacctgtacagccactattgtcctcattcttttcaagtgctgcctatgttgc
tgtagaagatgtggcaggattgcaaagaggaagaaggaatag

DBGET integrated database retrieval system