KEGG   Pelagibacterium halotolerans: KKY_1019Help
Entry
KKY_1019          CDS       T01645                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00230  Purine metabolism
phl01100  Metabolic pathways
Module
phl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KKY_1019
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KKY_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 TBCC_N DUF2524 SKI AAA_16 SRPRB RsgA_GTPase AAA_22
Motif
Other DBs
NCBI-ProteinID: AEQ51054
UniProt: G4RGJ5
Position
995847..996491
Genome map
AA seq 214 aa AA seqDB search
MMDFARRGVMLVIASPSGAGKSSISRQLFAQDPNIRLSVSITTRTRRTDEIDGTHYHFID
VPTFEKMRDRGELLEWAEVHGNYYATPREKVEERLSTGKDILFDIDYQGTLQLYENCRED
MVTVFILPPSIAELRARLERRAQDSVGTIEKRLRNARKEMEHYSEYDYVLVNEDLEQSVQ
MVRSILASARLQRGRQTKLEGFVDELKAQIDALG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatggattttgcgcgccgcggcgtcatgctggtgatcgcttcgccgtcgggggccggg
aaatcctcgatctcgcgccaattgttcgctcaggatcccaacatccgcctgtccgtctcg
atcaccacccgcacccgccgcaccgacgagatcgacggcacccattatcatttcatcgac
gtccccaccttcgagaagatgcgcgaccggggcgagctgctcgaatgggccgaggtccac
ggcaattattacgccaccccccgcgaaaaggtcgaggaacgtctctcgaccggcaaggat
atcctgttcgatatcgactaccagggcacgctgcagctctatgagaactgccgcgaggac
atggtcacggttttcatcctgcccccctcgattgccgaattgcgcgcccgcctcgaacgc
cgcgcccaggacagcgtcggcaccatcgaaaagcgcctgcgcaacgcccgcaaggagatg
gagcactattcggaatacgattacgtgctggtcaacgaagacctcgaacaatcggtgcag
atggtccgctccatcctcgccagcgcccgcctccagcgcggccgccagacaaagctcgaa
ggctttgtcgatgagttgaaagcccagatcgacgctttgggttag

DBGET integrated database retrieval system