KEGG   Pelagibacterium halotolerans: KKY_1246Help
Entry
KKY_1246          CDS       T01645                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
phl  Pelagibacterium halotolerans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KKY_1246
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    KKY_1246
Enzymes [BR:phl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KKY_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1218382..1220049
Genome map
AA seq 555 aa AA seqDB search
MTTTDYGWLEKAPFHLDAEARSWVHATRDAMSIEDKVAQLFVLISRGDDDEEQARIRRLR
PGGITRFFGPDAEGERGRLAALQSDAAVPLLVSADLEGSRMSLPFATQVPNPLALAALDD
VAVTRDISRIMAEEARAIGVNWSFTPVVDINAAFRSAIVATRGFGSDVETIERHALAQIE
EFQKRGVAATVKHWPGEGFDDRDQHLVTTINPLSMPDWEEHFGRLYRAAIAKGVLSVMSA
HIALPAYVRSLNPDAGIEAFRPASVSRLLNIDLLRHRLGFNGLIVSDASEMAGLGAWMPL
RGAKPQIIANGCDVILFSRSPEEDMDAVRAAVENGEISRVRLDDAITRILALKARLGLHD
NTGPDRRCELGAPEAVQAASAAIKGAPTLVKDVQNLVPIAPATHKRVLIFSGGIVSPLHG
EPAPMVLPQLLADNGFEVTLHTPGTVVTRENFDLVLYIFGEETLLTRGRIFLDWAKIGGD
FGASMQRHWHDIPTAIISFGYPYYLYDAPRVPTYINAYSTLDAMQAAVVDLLLGDGEFNS
NSPIDPFAGLEDARY
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaccgactatggctggctcgaaaaggctccctttcacttggacgccgaagcc
cgctcttgggttcacgccacccgcgacgcgatgagtatcgaggacaaggttgcgcaattg
ttcgttctcatctcgcgcggagatgacgacgaggaacaagcgcgcatcaggcgcctgcgt
cctggcggcatcacccgctttttcggtcccgatgccgagggagaacgcggccgcctcgcc
gcgttacaatccgatgccgcggtgccgctgcttgtcagcgccgaccttgaaggctcccgg
atgagcttgccattcgcaacccaggtgccaaacccgctggcgctcgcggcgctcgacgac
gttgcggtcacccgcgacatttcgcggatcatggccgaagaggcacgcgccattggcgtc
aactggtccttcacgcccgtcgtcgatatcaatgcggctttccgcagcgccatcgttgcc
acgcgaggcttcgggtcagacgtcgaaacgatcgaacgccatgcgctggcccagattgaa
gaattccagaagcgcggcgtcgcggcgaccgtcaagcattggccgggcgaaggtttcgac
gatcgcgaccagcatctggtgacgacgatcaacccgctgtccatgcccgattgggaagaa
catttcggacgattgtaccgcgcggcaatcgccaagggcgtcctcagcgtgatgtctgcc
cacatcgcattgcctgcttacgtccggagcctgaaccccgatgccggcatagaagcattc
aggcccgcctcggtcagccggctcctcaatatcgatcttttgcgccatcgattgggattt
aatggcctcatcgtctcagacgccagcgaaatggccgggctcggtgcgtggatgccgttg
cgtggggccaagccccagattattgccaatggctgcgatgtcatcctgttttcgcgatcg
cccgaagaagacatggacgccgtgcgggcagccgttgaaaatggggagatctcccgggtc
cgtctcgatgatgccatcacacgtatcctggcgctcaaggccagactcggacttcacgac
aataccggtcccgatcggcgttgcgagcttggtgcgccagaggccgtacaggccgcaagc
gcggccataaaaggtgcgccgacactcgtcaaagacgtgcagaacctcgtcccgatcgcc
ccggccacccataagcgggtgctgattttttcgggcggcatcgtcagcccgctgcatggg
gaaccggctccgatggttttgccgcagcttcttgcggacaacggcttcgaggtcacactc
cacacaccggggaccgtggtgacccgcgaaaatttcgatctggttctctacattttcggc
gaggaaacgctcctcacacgtggccgcattttcctcgactgggcgaaaatcgggggcgat
ttcggcgcgtccatgcagcgccattggcatgatattcctacagcgatcatctcgttcggg
tatccctattacctgtatgacgcgccacgggtgccgacctacatcaacgcctacagtacg
ctcgatgccatgcaggcggcggtcgtcgaccttttgcttggcgatggcgagttcaattcc
aacagtccgatcgatccgttcgccggccttgaggatgcgaggtattga

  All links  
No link information was found.   
DBGET integrated database retrieval system