KEGG   Pelagibacterium halotolerans: KKY_1371Help
Entry
KKY_1371          CDS       T01645                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01130  Biosynthesis of antibiotics
phl01230  Biosynthesis of amino acids
Module
phl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KKY_1371
Enzymes [BR:phl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KKY_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEQ51393
UniProt: G4R8X6
Position
complement(1349454..1350251)
Genome map
AA seq 265 aa AA seqDB search
MTDILRKIEAYKREEIAAAKSAVPLAELTAMAREQDAPRGFIAALKAKRATGKYGLIAEV
KKASPSKGLIRPDFDPPVLAKAYEDGGAACLSVLTDTPSFQGRPEFLGAARSATGLPALR
KDFLFEPYQVVEARAWGADCILIIMASVDDVAARTLLESAAEWGMDALVEVHDAEETERA
LALGADFIGINNRNLRTFEVTLETTVALAKLVPDDKLLVSESGVFAHDDIKYLEAEAGVG
CFLVGESLMRQSDVAAATRTLLMGA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattctgcgcaagatcgaggcctataagcgcgaggaaatcgcggcggccaaa
tcggctgtgccactggccgagttgaccgcgatggcgcgcgagcaggacgcgccgcgcggt
tttatcgccgcgttgaaggccaagcgggccaccgggaaatacgggctgattgccgaggtc
aaaaaggccagtccatccaaaggattgatccgacccgatttcgatccgccggttttggcc
aaggcctatgaagacggtggcgcggcgtgcctttcggtgctaaccgatacgccatcgttt
caggggcggccggagttccttggcgcggcgcggtcggcgacgggacttccggcgctgcgc
aaggattttctgttcgaaccctatcaggtggtggaagcgcgcgcctggggggcggactgc
attctgatcatcatggcatcggtcgacgatgttgccgctcggactttgcttgaaagcgct
gccgagtggggtatggacgcgctcgtggaagttcatgacgctgaagaaaccgagcgtgcg
ctggcgctgggcgccgatttcatcggcatcaacaatcgtaatctgcggaccttcgaggtg
acgctggaaaccaccgtcgctctggccaaactggtgccggacgacaagcttctggtatcc
gagagcggcgtctttgcccatgacgatatcaaatatctcgaagccgaggctggcgtcggg
tgcttcctggtcggggagagcctgatgcggcagtccgatgtggcggcggcgacccgtacg
ctgttgatgggagcctga

DBGET integrated database retrieval system