KEGG   Pelagibacterium halotolerans: KKY_1376Help
Entry
KKY_1376          CDS       T01645                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
phl  Pelagibacterium halotolerans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KKY_1376
   01230 Biosynthesis of amino acids
    KKY_1376
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KKY_1376
   00051 Fructose and mannose metabolism
    KKY_1376
   00562 Inositol phosphate metabolism
    KKY_1376
Enzymes [BR:phl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KKY_1376
Exosome [BR:phl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KKY_1376
  Exosomal proteins of bladder cancer cells
   KKY_1376
  Exosomal proteins of melanoma cells
   KKY_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1356894..1357649
Genome map
AA seq 251 aa AA seqDB search
MQERLRPLIAGNWKMHGTGAALEQIARLKTLLQEAGDIESEVLICPPATLLDRAARRAQS
SAIRIGGQDCHADPGGAHTGDISASMLLDAGASHVILGHSERRADHGETSDIVRDKTKAA
LAAGLIPIICVGETEAERLAGTANQVVGEQIDLSLPDAFGETPIIIAYEPVWAIGTGRTP
TTDDIAHMHAHMRNLLVARFGTAGESALLLYGGSVKPSNAEEILRTPEVNGALVGGASLL
ADDFFSIIVAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagcgattgcggccattgattgccggaaactggaagatgcatgggacgggcgcc
gcgctcgagcagatcgcacggctcaagacccttctccaggaagccggcgatatcgaaagc
gaggtgctcatatgcccaccggcgacgctgctcgacagagcagcccgaagagcccagagc
agcgcaatccgcatcggcgggcaggactgccacgccgatcccggcggagcccacacggga
gacataagcgcctccatgctgctcgacgccggagcgtcccacgttatccttggtcactcc
gagcgccgcgccgaccatggcgaaacgagcgatatcgtgagggacaagaccaaagccgcg
ctggctgccggtcttatcccgatcatttgcgtcggcgaaaccgaggccgagcgtcttgca
gggaccgcgaatcaggtggttggcgagcagatcgatctttcactgccggatgccttcggc
gagacgccgattatcatcgcctacgagccggtgtgggccatcggcaccggacggacgcca
acgactgacgatatcgcccatatgcacgcccacatgcgcaacctgctggtcgcgcgtttc
ggcacggcaggggagagtgcgttgctgctctatggtggttcggtaaagccttccaacgcc
gaagaaatcctgcgcacgccagaggtcaacggtgctctggtcggcggcgcgagcctgctt
gcggacgacttcttttccatcatcgtcgccgcctga

DBGET integrated database retrieval system