KEGG   Pelagibacterium halotolerans: KKY_1471Help
Entry
KKY_1471          CDS       T01645                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
phl  Pelagibacterium halotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1455750..1456394)
Genome map
AA seq 214 aa AA seqDB search
MTDYWEARAGLILNLRQHGVTDPEILRAFETVPHERFVPEDFREYAYRESSLPIECGQSI
TAPGLLAQLLVPLAPQGASKVLEVGTGSGYSAALLSRMARRVFSIEKHRILAKSAQARWQ
GLGYTNIVGLNEDGLAGLEQQAPFDRILLTGSVGEVPEDLVEQLADGGIAVMAVGAPSER
QAIVRIERADDSFIETETGTARLAPLSPGRVRGP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgattactgggaagcgcgggccggcctgatcctgaaccttcgccagcatggggtg
accgacccggaaatcctgcgcgcttttgaaaccgtgccgcacgaaagattcgtgcctgag
gatttccgcgaatacgcctatcgagaatcgtcgcttcccatcgaatgcgggcaatcgatc
acggcgcccggccttttggcgcaattgctggtgccgttggcgccacagggggcaagcaag
gtgctggaggtgggaacaggttcgggctattcggccgcgctgttgtcgcggatggcaagg
cgggtgttctcgatcgaaaagcacaggatattggccaagagcgctcaagcgcgctggcaa
gggttgggctataccaacatcgtggggctcaatgaggacgggttggccgggctggagcag
caagcgcccttcgaccgcatccttctgaccggttcggtgggcgaggtacccgaggatctc
gtcgagcagcttgccgatgggggaatcgcggtgatggcggttggcgcgccttccgagcgg
caggccatcgtgcgcatcgagcgggccgacgacagctttattgaaacggaaaccgggacg
gcaaggctggcgccgcttagccccggacgggtgcgtggcccgtaa

DBGET integrated database retrieval system