KEGG   Pelagibacterium halotolerans: KKY_1528Help
Entry
KKY_1528          CDS       T01645                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
phl  Pelagibacterium halotolerans
Brite
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     KKY_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1512038..1513102
Genome map
AA seq 354 aa AA seqDB search
MTNLDFDRASGFANAALALLKRAQIPPFPVYYELFYTYATGSNAELNTQVNALLTRSGTI
SVEEASDLCEKFLKVSDMEEKLRAMSQVMSRKITDVNQAIDVAMVSANSYSGSLQQASGD
LHAGGIDEDALKMLSSRLLKETRRMQDMNRRLEAELENSKDDISVLQRDLDEVRKESMLD
PLTKIPNRKCFDEQLSADLERTHAQNATLSLLLFDIDSFKAFNDTYGHLTGDQVLRLVAH
VLKANLKGRDMPARFGGEEFVAILPETELAGAVTVAENIRRSVQAKELLKRSTNEKLGRI
TLSVGVAQWRPGDTAAALIERADKCLYAAKGAGRNRVVSEKDLPDFSTTSTDVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaacctggactttgatcgcgcatcaggatttgccaatgcagcgcttgccttgctc
aagcgcgcgcagattccgccgttccccgtctattatgaattgttctacacttacgcgacc
ggttccaatgccgagctcaatacgcaggtcaatgcactcttgacccgctcgggcaccatc
tcggtcgaggaagcttcggacctttgtgagaagtttctcaaggtctccgacatggaagaa
aagctgcgggccatgtcgcaggtgatgagccgcaagatcaccgacgtgaatcaggccatc
gatgtcgccatggtgagcgccaattcctattcgggctcgctccagcaggcgtcgggcgat
ctccatgccggcggcatcgatgaggacgcattgaaaatgttgtcctctcgcctgctcaag
gaaacgcgccgcatgcaagacatgaatcggcggctcgaagccgaactcgaaaattccaag
gacgatatttcggttctccagcgcgacctcgatgaagttcgcaaggaatcgatgctcgat
ccgctgaccaaaattcccaatcgcaaatgttttgacgagcagctttctgctgatctcgag
cgcacccacgcccagaacgcaacgctgtcgcttctgctgttcgatatcgacagcttcaag
gcgttcaacgacacctatggccacctgaccggcgatcaggtgctgcggctcgtcgcccac
gttctcaaggccaacctcaagggacgtgacatgcctgcccgtttcggcggtgaagagttt
gtcgctatccttcccgaaaccgagctcgctggcgccgttaccgtcgccgaaaacatccgg
cgctcggtgcaggccaaagaacttctcaagcgttcgaccaatgagaaacttgggcgcatc
acactttcggtcggtgttgcacaatggcgccccggcgacacggccgcggctctcatcgaa
cgcgcggacaagtgcctttatgctgccaagggcgcaggccgaaatcgcgtggtgtccgaa
aaagaccttcccgacttctcgactacatcaaccgatgtggcttga

DBGET integrated database retrieval system