KEGG   Pelagibacterium halotolerans: KKY_1528Help
Entry
KKY_1528          CDS       T01645                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
phl  Pelagibacterium halotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1512038..1513102
Genome map
AA seq 354 aa AA seqDB search
MTNLDFDRASGFANAALALLKRAQIPPFPVYYELFYTYATGSNAELNTQVNALLTRSGTI
SVEEASDLCEKFLKVSDMEEKLRAMSQVMSRKITDVNQAIDVAMVSANSYSGSLQQASGD
LHAGGIDEDALKMLSSRLLKETRRMQDMNRRLEAELENSKDDISVLQRDLDEVRKESMLD
PLTKIPNRKCFDEQLSADLERTHAQNATLSLLLFDIDSFKAFNDTYGHLTGDQVLRLVAH
VLKANLKGRDMPARFGGEEFVAILPETELAGAVTVAENIRRSVQAKELLKRSTNEKLGRI
TLSVGVAQWRPGDTAAALIERADKCLYAAKGAGRNRVVSEKDLPDFSTTSTDVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaacctggactttgatcgcgcatcaggatttgccaatgcagcgcttgccttgctc
aagcgcgcgcagattccgccgttccccgtctattatgaattgttctacacttacgcgacc
ggttccaatgccgagctcaatacgcaggtcaatgcactcttgacccgctcgggcaccatc
tcggtcgaggaagcttcggacctttgtgagaagtttctcaaggtctccgacatggaagaa
aagctgcgggccatgtcgcaggtgatgagccgcaagatcaccgacgtgaatcaggccatc
gatgtcgccatggtgagcgccaattcctattcgggctcgctccagcaggcgtcgggcgat
ctccatgccggcggcatcgatgaggacgcattgaaaatgttgtcctctcgcctgctcaag
gaaacgcgccgcatgcaagacatgaatcggcggctcgaagccgaactcgaaaattccaag
gacgatatttcggttctccagcgcgacctcgatgaagttcgcaaggaatcgatgctcgat
ccgctgaccaaaattcccaatcgcaaatgttttgacgagcagctttctgctgatctcgag
cgcacccacgcccagaacgcaacgctgtcgcttctgctgttcgatatcgacagcttcaag
gcgttcaacgacacctatggccacctgaccggcgatcaggtgctgcggctcgtcgcccac
gttctcaaggccaacctcaagggacgtgacatgcctgcccgtttcggcggtgaagagttt
gtcgctatccttcccgaaaccgagctcgctggcgccgttaccgtcgccgaaaacatccgg
cgctcggtgcaggccaaagaacttctcaagcgttcgaccaatgagaaacttgggcgcatc
acactttcggtcggtgttgcacaatggcgccccggcgacacggccgcggctctcatcgaa
cgcgcggacaagtgcctttatgctgccaagggcgcaggccgaaatcgcgtggtgtccgaa
aaagaccttcccgacttctcgactacatcaaccgatgtggcttga

DBGET integrated database retrieval system