KEGG   Pelagibacterium halotolerans: KKY_1602Help
Entry
KKY_1602          CDS       T01645                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KKY_1602
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KKY_1602
Enzymes [BR:phl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     KKY_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1604756..1605658
Genome map
AA seq 300 aa AA seqDB search
MGIAQLNPVEIIDLLDRAEAMIPISRQRKTLPSLAGKTQINLFFENSTRTQASFEIAGKR
LGATVMNMAVRTSSVAKGETLIDTAATLNAMQPDAIVVRHGSSGAVELLSQKVECAVLNA
GDGAHEHPTQALLDALTIRRHKGRLNGLTVAICGDIANSRVARSNLILLGAMQARTRVIA
PKSLLPRGVEQMASEVFTDMEKGLEGADVVMMLRLQNERASGKLIPSVREYYRFYGLDAD
KLARANADALVMHPGPMNRGVEIDPAIADGPQSVITEQVEMGVAVRMAVLDALLNKEEDK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgggaatcgcccaactcaacccggtcgagatcatcgatcttctggaccgggccgaggcg
atgatccccatatcgcgccaacgcaagacgctgccgagcctggcgggcaagacccagatc
aatctgtttttcgaaaattcgacccgcacccaggcgagtttcgagatcgccggcaaacgt
ctgggggcaacggtcatgaacatggccgtgcggacctcctcggtcgccaagggcgaaacg
ctgatcgatacggcggcgacgctcaacgccatgcagcccgacgccatcgtggtgcggcac
ggctcgtccggcgcggtggaactgctgagccagaaggtcgaatgcgcggtgctcaacgcc
ggggacggcgctcacgagcaccccacacaagccctgctcgacgcgttgaccatccgccgc
cacaaggggcggctgaacgggctgaccgtggccatctgcggcgatatcgccaattcgcgc
gttgcgcgctcgaacctcattcttctgggcgccatgcaggcccgtacgcgggtcattgcg
cccaaatcgcttctgccgcgcggtgtcgaacagatggcctcggaagtcttcaccgacatg
gaaaagggcctcgagggcgccgatgtcgtgatgatgctgcggctccagaacgagcgcgcc
tcgggcaagctgatcccctcggtgcgcgagtattatcgcttctacgggctcgatgccgac
aaactggccagagccaatgccgacgcgctggtcatgcatcccgggccgatgaatcggggc
gttgaaatcgatccggccattgccgacgggccgcaatcggtgattaccgaacaggtcgag
atgggcgttgccgtgcgcatggcggtgctcgatgcgctgctcaacaaggaggaggataaa
tga

DBGET integrated database retrieval system