KEGG   Pelagibacterium halotolerans: KKY_1638Help
Entry
KKY_1638          CDS       T01645                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
phl  Pelagibacterium halotolerans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KKY_1638
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     KKY_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1638997..1639443
Genome map
AA seq 148 aa AA seqDB search
MARAVLALGANIGDPAHQIATAIEAIAGHPRISLLKQSALIVSEPWGKTDQNRFHNGAIL
IETTLSPLDLLDFCLVTEAQIGRVRIEKWGPRSIDIDIITYDDLTMETERLTLPHPYAHE
RDFVLEPLREIAPDVADWLLNQAGNKSA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgccgttctggcgctgggcgccaatattggcgatcccgcgcaccagatcgcc
acggccatcgaggccatcgccggccatccccggatttcccttttgaaacaaagtgcgttg
atcgtcagcgaaccctggggcaagaccgaccagaaccgcttccacaacggcgccatcctg
atcgaaaccacgctatctcccctcgaccttctcgacttctgccttgtcaccgaagcccaa
atcggacgcgtccgtattgagaaatggggcccgcgcagcatcgatatcgacatcatcacc
tacgatgatctgacgatggaaaccgagcgcctgaccctgccgcacccttacgcccacgag
cgcgatttcgtgctcgagccgctgcgcgagatcgcgccggatgtggccgactggctattg
aatcaggcaggcaacaaatcagcctaa

DBGET integrated database retrieval system