KEGG   Pelagibacterium halotolerans: KKY_1760Help
Entry
KKY_1760          CDS       T01645                                 

Definition
(GenBank) GTP cyclohydrolase I type 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00790  Folate biosynthesis
phl01100  Metabolic pathways
Module
phl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KKY_1760
Enzymes [BR:phl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KKY_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF UPF0262 EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: AEQ51772
UniProt: G4RDH1
Position
1750121..1750780
Genome map
AA seq 219 aa AA seqDB search
MRPSIFKGTPFMDMNVKPKPAQTALDRVIERPTREEAEAAVRTLIAWAGDNPDREGLLDT
PRRVADAYREFFAGYEEDARAVLETTFTEVGGYDDIVLVRDIPFHSHCEHHMVPFVGKAH
IAYLPHDGVVGLSKLARVTDVFAKRLQTQENLTAQIIEAINEAINPRGAAVMLEAEHMCM
SMRGIKKHGSSTVTHRFTGVFAEDRQEQDRFFALIRAGR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgtcgattttcaaggggacacccttcatggacatgaacgtcaagccaaagcct
gcgcagaccgcgctcgaccgcgtgatcgaacgccccacgcgcgaagaggccgaggcggcg
gtccgcacgctgattgcctgggccggagacaaccccgaccgcgaaggactgctcgacacc
ccgcgccgcgtcgccgatgcctatcgtgaatttttcgcgggctatgaggaagacgcccgg
gcggttctggaaaccaccttcaccgaagtcggaggctacgacgacatcgtgctggttcgc
gacatcccgttccattctcactgcgagcaccacatggtgcccttcgtgggtaaggcccat
atcgcctatctgccccacgacggtgtggtgggtctgtccaagctggcgcgagtgaccgac
gttttcgccaaacggctccagacccaggaaaacctcacagcccagatcatcgaggcgatc
aacgaggcgatcaatccgcgtggcgccgccgtgatgctcgaggccgagcacatgtgcatg
tcgatgcgcggcatcaaaaagcacggctcgtccacggtgacccatcgcttcaccggggtt
tttgccgaggaccggcaggaacaggaccgcttcttcgccctcatccgcgccgggcgatag

DBGET integrated database retrieval system