KEGG   Pelagibacterium halotolerans: KKY_1909Help
Entry
KKY_1909          CDS       T01645                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
phl  Pelagibacterium halotolerans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:phl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:phl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1889162..1890259)
Genome map
AA seq 365 aa AA seqDB search
MRIFASLCLVLGLAVSSSAAPAQSLEDMAGQMVMVGFSGDTADAAGVRAVREQIARGEIG
GVMYLRTNVDSLAAVRGINRRLIAARPWLPPFIALDQEGGEIERLTAAVGFGEIPSARAV
ASDAPDRARAIYAGLADELARLGFNANFGPVVDLDLNPDNPIIARYQRAFGSDPDQVVAL
ASAFVEAHRDAGIATALKHFPGHGSSAGDTHDGFVDVTGLWQPVELEPYRAMIDGGLADM
VMVAHLFNGDVQGGDSRQLPASLSRTWIEGVLRDELGFTGVAISDDLEMGAIRSRFDLHD
TVVRAVEAGMDILLFSNTAAYDPALGSEIHRVLVEEGRADPAFAARIAQSYGRIIALKRK
IGIIP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatttttgcctccctttgtcttgtccttggccttgccgtaagcagctccgccgcg
ccggcacaaagtctcgaggacatggcagggcagatggtcatggtgggattttccggtgac
accgccgatgccgccggcgtgcgcgcggtgcgtgaacagattgcgcgcggcgagattggc
ggcgttatgtatctgcgcacaaatgtggacagccttgcggcggtgcgcggcatcaatcgc
cgcctgattgccgcccggccatggttgccgcccttcatcgcgctcgaccaggaagggggc
gaaatcgaacgcctgacggctgcggtgggctttggggaaatcccatcggcgcgtgcggtt
gcaagcgatgcgccggatcgggcgcgggccatctatgccggcctggccgacgaattggcg
cggctggggttcaacgccaatttcggtccggtggtcgatctcgacctcaatcccgacaat
ccgatcatcgcccgctaccaacgggccttcggctccgatcccgaccaggtcgtcgccctt
gcatcggcctttgtcgaggcgcatcgcgacgcggggatcgccaccgcgctcaagcatttt
ccggggcatggttcgagcgctggggatacacatgacgggttcgtggacgtcacggggctc
tggcaacctgtggagctcgagccctatcgcgcgatgatcgatggggggctggccgatatg
gtcatggtggcccacctgtttaacggtgacgtccagggcggagattcgcgccagttgccg
gccagtctttcgcggacctggatcgaaggcgtcctgcgcgacgaactgggctttaccggc
gtggcgatcagcgacgatctggagatgggagccatccgctcgcgtttcgatcttcacgat
acggtcgtcagggccgtggaggcgggcatggacattctgctgttttccaataccgctgcc
tacgatccggcgctgggcagcgaaatccaccgggttcttgtcgaggaagggcgggccgac
ccggcattcgccgcccggatcgcccagagctacgggcgcatcattgcgctgaagcgcaag
atcgggatcatcccgtga

DBGET integrated database retrieval system