KEGG   Pelagibacterium halotolerans: KKY_1941Help
Entry
KKY_1941          CDS       T01645                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
phl  Pelagibacterium halotolerans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KKY_1941
Enzymes [BR:phl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     KKY_1941
    3.5.1.-  
     KKY_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922201..1922800)
Genome map
AA seq 199 aa AA seqDB search
MATKALIVIDVQNDFCPGGALAVDEGDRVVPVINQLMGQFDHVILTQDWHTADHSSFASQ
HPGKAPFDDIEMAYGSQRLWPDHCIQGSHGADFHPELNLVPAELVIRKGFRTPIDSYSAF
FENDHTTPTGLTGYLRERGLSELTFVGLATDFCVAYSALDAVGQGFSARVMLEACRGIDL
MGSMETMIGKMKADGVDVI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaaagcgttgatcgtcatcgatgtgcagaacgatttctgcccaggaggggcg
ttggcggtggatgagggcgaccgggtggtgccggtcatcaaccagctcatggggcagttc
gaccatgtcatcctgacccaggactggcacacggcggaccattcgagctttgcctcccaa
caccccggcaaggcgccgttcgatgatatcgaaatggcgtatggcagccagcggctatgg
ccggatcattgcatccagggcagccatggcgccgatttccatcccgaattgaacctggtg
cccgctgaattggtgatccgcaaagggtttcggacaccgatcgattcctattcggcgttt
ttcgagaacgatcacacgacgccaaccgggctgacggggtatctgcgcgagcgggggctg
agtgagcttacgttcgttgggctggccaccgatttctgcgtcgcctattcggcgctcgac
gctgtggggcaggggttttcggcgcgggtgatgctggaggcttgccgggggatcgacctg
atgggatcgatggagacgatgatcgggaagatgaaggccgacggggtggacgtgatttga

DBGET integrated database retrieval system