KEGG   Pelagibacterium halotolerans: KKY_1952Help
Entry
KKY_1952          CDS       T01645                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00670  One carbon pool by folate
phl00790  Folate biosynthesis
phl01100  Metabolic pathways
Module
phl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KKY_1952
   00670 One carbon pool by folate
    KKY_1952
Enzymes [BR:phl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KKY_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 DUF2188
Motif
Other DBs
NCBI-ProteinID: AEQ51962
UniProt: G4RFC4
Position
complement(1930505..1931014)
Genome map
AA seq 169 aa AA seqDB search
MSAVIAMIAAVGRNGAIGAGGDLPWRLPTDFAFYKRTTMGKPLIMGRKTFESIGKPLAGR
TNIVVTRSADFAAEGVEVFGDLAAAIARGREIAGRDGVDEVFINGGGEIYRAAMPLAERL
YITHVDAAPDGDTYFPQIDPAVWAGTVLSEIVPGEKDSAGFAITVYERR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtgattgcgatgatcgctgcggtggggcgcaatggggccatcggggcgggc
ggcgatctgccctggagattgccgaccgactttgcgttctacaaacgaacgacgatgggc
aagccgctgataatggggcgcaagacgttcgagagcatcggcaagcccttggcgggacgg
acaaatatcgtggtgacgcgcagcgccgattttgcggccgagggtgtcgaggtgttcggc
gatttggcagcggcgattgcgcgggggcgcgagattgccggacgggacggggtggacgag
gtgttcatcaatgggggcggggagatctatcgcgccgccatgcctctggcggagcggctc
tatatcacgcatgtggacgccgcgccggacggcgatacgtattttccgcagatcgatccg
gcggtctgggccggcacggtgctgtccgaaatcgtgcccggagaaaaggacagcgcaggc
tttgccattactgtgtatgagcgccgctag

DBGET integrated database retrieval system