KEGG   Pelagibacterium halotolerans: KKY_2047Help
Entry
KKY_2047          CDS       T01645                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
phl  Pelagibacterium halotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KKY_2047
Enzymes [BR:phl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KKY_2047
Exosome [BR:phl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KKY_2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2029351..2031552)
Genome map
AA seq 733 aa AA seqDB search
MAKKQSGWQADPKQIARVVSGQHDDPFSILGLHESDGQWTLRALVPHAQWIEARTLDGKA
LGKLEKRDDAGFFEGRVAMDRFQPVLYHAGNEGGEWDVIDPYSFGPVLGPMDDYYIGEGS
HLRLFDKMGAHFMTFEGVEGTHFAVWAPNAQRVSVVGSFNDWDGRRHPMRRRNEIGIWEI
FLPGVLPGAQYKYEILGKAGNLLPLKADPYAQQTEMRPKTASVVADPTPFAWTDNAYMEA
RKSRDYRREPMSVYEVHLGSWRKRPDGGFLSYDQLADQLVPYAADMGFTHIELLPISEHP
YDPSWGYQPTGLYAPTARFGDPAGFARFVDAAHNAGLGIILDWVPAHFPTDEHGLAKFDG
TALYEHADPRQGYHPDWNTAIYNFGRKEVSSFLTNNALYWLEKFHIDGLRVDAVASMLYL
DYSRQPGQWVPNSQGGNENIEAIAFLQRVNAETYGNHPGTFTVAEESTSWPGVTAPTYAK
GLGFGFKWNMGFMNDTLRYMQREPIHRRFHHHDLTFGLLYAFSENFTLPLSHDEVVHGKG
SLLTKMPGDDWQKFANLRAYYAFMWGYPGKKLLFMGQEFAQREEWNEAHALDWWLLDAQF
HEGVRRLVSDLNTVYRELPALHGRDCEPEGFEWIIANDQANSVLAWVRKAPDAAPVVVIT
NLTPVPREKYRLPMPAAGRWIERINTDAGWYAGSNTGNQGVVNATKGNEFGYPATAEIVL
PPLSTLILQFEPE
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaaaagcagtccggttggcaggccgatcccaaacagatcgctcgcgtggtgagc
ggccagcacgacgacccgttctccattctgggcctgcacgagagtgacggccaatggaca
ctccgtgcactcgtgccccacgcccaatggatcgaggcgcgcacgctcgacggcaaggcc
ttgggaaagctggaaaaaagggacgatgcgggatttttcgaaggccgtgtggccatggac
cgttttcagcccgtactctaccacgccggcaatgaggggggagagtgggatgtgatcgat
ccctattccttcggtccggtgctcggcccgatggacgattattacatcggcgaggggtcc
catctgcgtctgttcgacaagatgggcgcccatttcatgacattcgagggcgttgaaggc
acccatttcgccgtctgggcaccgaacgcgcagcgggtttcggtggtgggctcgttcaac
gactgggacggtcggcgccatccgatgcggcggcgcaacgaaatcggcatctgggaaatc
ttcctgcccggcgtcctgcccggcgcccagtacaaatacgagatcctcggcaaagcgggg
aacctgctgccgctcaaggcagacccctacgctcagcaaacggagatgcggccaaagacc
gcctcggtggtggccgatccgacgccgttcgcctggaccgataacgcctatatggaagcg
cgtaagtcgcgcgactaccggcgcgagccgatgagcgtttatgaggtccatctcggttcg
tggcgcaaacggcccgatggcggcttcttgagctatgaccagcttgccgaccagcttgtg
ccctatgcggcggacatggggttcacccatatcgaattgctgccgatctccgagcatccc
tacgatccgagctggggctatcagcccaccgggctgtatgcgccgacggcccggttcggc
gatccggccgggttcgcccggttcgtcgatgcggcccacaatgcggggctggggatcatc
ctcgattgggtgcccgcccatttcccgaccgacgagcacggactggccaagttcgacggc
accgcgctttacgaacacgccgatccgcgtcagggctaccacccggactggaacacggcg
atctacaatttcgggcgcaaggaagtctcgagctttctgaccaacaatgcgctctactgg
ctggaaaaattccacatcgacgggctgcgggtcgatgcggtggcgtccatgctctacctg
gattattcgcgccagccgggccagtgggtgcccaacagccagggcggcaacgaaaatata
gaggcgatcgccttcctccagcgcgtcaatgcggagacctatggcaaccaccccggcacg
ttcacggtggcggaggaatcgacgagctggccgggcgtgaccgcgccgacctatgccaaa
gggctggggttcgggttcaagtggaacatggggttcatgaacgacacgctgcgctacatg
cagcgtgagccgatccatcgccgcttccatcatcacgacctgacgttcgggctgctctac
gcgttctcggagaatttcaccctgccgctcagccatgacgaggtggtccatggcaagggt
tcgttgctcacgaaaatgccgggcgacgactggcagaagtttgcgaaccttcgcgcctat
tacgccttcatgtggggctatccgggcaagaaactgctgttcatggggcaggagttcgcc
cagcgcgaggaatggaacgaggcccatgcgctcgactggtggctgctcgacgcgcagttc
cacgagggggtgcggcggctggtgtcggacctcaacaccgtatatcgcgaactcccggcg
ctgcacggccgggattgcgaacccgaggggttcgaatggatcatcgccaacgatcaggcc
aattccgttttggcctgggtgcgcaaggcacccgatgcagcgccggtggtggtcatcacg
aacctgacgccggttccgcgcgaaaaataccggctgcccatgccggccgcggggcggtgg
atcgagcgcatcaacaccgacgccggctggtatgccggctccaacaccggcaatcagggc
gtggtcaacgcaaccaaaggcaatgaattcggttatccggcaactgcggaaatcgttctg
ccgccgctgtcgaccctcatcctgcaatttgaaccggaatag

DBGET integrated database retrieval system