KEGG   Pelagibacterium halotolerans: KKY_2232Help
Entry
KKY_2232          CDS       T01645                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KKY_2232
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KKY_2232
   00630 Glyoxylate and dicarboxylate metabolism
    KKY_2232
Enzymes [BR:phl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KKY_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2213234..2215402)
Genome map
AA seq 722 aa AA seqDB search
MSSYVTRAGLQVDEQLAAFVEQEALKGPDVASDRFWAGFAEMVAAYMPGNRELLEIRDRM
QNQIDDWHRDNGPATANPEAYQAFLREISYLEDEPEDFRIETENLDPEIASICGPQLVVP
VSNARYALNAANARWGSLYDAFYGTDVIAREGDLAPGRQYNAKRGAEVFARAGHFLDEAF
PLLGVKHWAVTRYGVDISGDVARLVIESQDGRAKLAYPEAFAGYSRDGDVLRILLKHHGL
HVDLVIDPNHPVGKDHPANLADVAIESALTTIQDCEDSVAAVDAEDKVGVYRNWLGLMKG
DLADTFEKGGKSVTRTLNADRVYTAPDGSELTLKGRALLLVRNVGHLMTTDAILDAEGQP
IGEGLMDAAITTLCALHDRKRKANSTTGSIYIVKPKMHGPTEVLFACNVFGEVEKILGLP
LNTIKIGIMDEERRTSANLKACIYAARERVFFINTGFLDRTGDEIHTSMEAGPVLLKDQI
KAERWIQAYEDRNVTIGIACGLTGRAQIGKGMWARPDDMAAMMEQKIGHPKSGANCAWVP
SPTAATLHALHYHEVDVFEAQKRRHNEPIPGLDALFSMPVLDPATLSAEQIQRELDNNAQ
GILGYVVRWVDAGVGCSKVPDINNVGLMEDRATCRISSQAIANWLWHGVVTQDEVVATFT
RMARVVDQQNAGDPAYEPMSGDPEHSIAFQAALALALQGVEQPSGYTEPLLHAKRAEKKA
QR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctatgtcacccgagccggtttgcaggtcgatgaacagcttgccgcgtttgtc
gagcaagaggcgctcaagggacccgatgtcgcttcggacaggttctgggcggggtttgcc
gagatggtcgcggcctatatgccgggcaatcgcgagctcctggaaatccgcgacaggatg
cagaaccagatcgacgactggcaccgcgacaatggcccggcaacagcgaacccggaggcc
tatcaggcgtttttgcgcgagatcagctatctcgaggacgagccggaggatttccggatc
gaaactgaaaatctcgatcccgagatcgcctcgatctgcggcccgcagcttgtcgtgccg
gtgtccaatgcgcgctatgcgctcaatgccgccaatgcgcgctggggcagtctctacgat
gcgttttacggcactgatgtgatcgcccgtgagggcgatctggcaccggggcgtcagtac
aatgccaagcgcggtgcggaagtgtttgcgcgggccgggcatttccttgacgaggcgttt
ccgttgctcggggtcaagcactgggccgtgacacgctatggcgtcgatatatcgggagat
gtcgccagactggtgattgaaagtcaggatggccgggcgaaactggcttatcccgaggcg
ttcgcgggctattcgcgcgatggcgatgtgctgcgcatcctgctcaagcaccacgggctg
catgtcgacctggtgatcgatcccaaccatccggtgggcaaggatcatccggccaatctg
gctgatgtggcgatcgaaagcgcgttgaccacaattcaggattgcgaggattcggttgcg
gcggtcgatgccgaggacaaggtcggggtctatcgcaactggctcgggctgatgaagggc
gatctggccgatacgttcgaaaagggcggcaagagtgtcacacggacgctcaatgcggat
cgggtttacacagcaccggatggaagcgagttgaccctgaaggggcgcgcattgctgctg
gtgcgcaatgtcgggcatctgatgaccaccgatgccattcttgacgctgaaggccagccg
atcggcgaggggctgatggatgcggcgatcaccacgctttgcgcgctgcacgaccgcaag
cggaaggccaattcaacaaccggctcgatttatatcgtcaagcccaagatgcacgggccg
accgaagtgctgtttgcgtgcaatgtgttcggggaagtggaaaaaatcctcgggctgccg
ctcaacaccatcaagatcggcatcatggacgaggagcgccggacctcggccaacctcaaa
gcgtgcatttatgcagcgcgtgaacgggtgttttttatcaacaccgggttcctcgaccgc
accggtgacgaaatccatacgtcgatggaagccgggccggtgctgctcaaggaccagatc
aaggccgaacggtggattcaagcctacgaggatcgcaacgtcacgatcggtattgcctgc
gggctgacgggccgcgctcagatcggcaagggcatgtgggcccggcccgacgatatggcg
gcgatgatggagcaaaagatcgggcatccgaaatcgggcgccaattgcgcctgggtgcct
tcgccgacggcggcaacgctgcacgcgctccactatcatgaggtcgacgtgttcgaggcg
caaaagcgccggcacaacgaacccattcccggtctggacgccttgttttccatgccggtg
cttgatcccgcgacgctctcggccgagcagatccagcgcgaactcgacaacaatgcgcaa
gggatcctgggctatgtggtgcgctgggtcgatgcgggggtggggtgttcgaaagtcccc
gacatcaacaatgtgggactgatggaagaccgggcgacctgccgcatttcatcgcaggcc
atcgccaactggctctggcatggggtggtgacccaggacgaggtggtggcgaccttcacc
cggatggcccgggtggtcgatcagcagaatgcgggtgatccagcctatgagcccatgagc
ggtgatcccgaacactcgattgcctttcaggccgcattggctttggcactgcaaggggtc
gaacagccttctggttataccgagccgctgttgcacgccaagcgggccgaaaagaaagct
caacgatag

DBGET integrated database retrieval system