KEGG   Pelagibacterium halotolerans: KKY_2232Help
Entry
KKY_2232          CDS       T01645                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KKY_2232
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KKY_2232
   00630 Glyoxylate and dicarboxylate metabolism
    KKY_2232
Enzymes [BR:phl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KKY_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2213234..2215402)
Genome map
AA seq 722 aa AA seqDB search
MSSYVTRAGLQVDEQLAAFVEQEALKGPDVASDRFWAGFAEMVAAYMPGNRELLEIRDRM
QNQIDDWHRDNGPATANPEAYQAFLREISYLEDEPEDFRIETENLDPEIASICGPQLVVP
VSNARYALNAANARWGSLYDAFYGTDVIAREGDLAPGRQYNAKRGAEVFARAGHFLDEAF
PLLGVKHWAVTRYGVDISGDVARLVIESQDGRAKLAYPEAFAGYSRDGDVLRILLKHHGL
HVDLVIDPNHPVGKDHPANLADVAIESALTTIQDCEDSVAAVDAEDKVGVYRNWLGLMKG
DLADTFEKGGKSVTRTLNADRVYTAPDGSELTLKGRALLLVRNVGHLMTTDAILDAEGQP
IGEGLMDAAITTLCALHDRKRKANSTTGSIYIVKPKMHGPTEVLFACNVFGEVEKILGLP
LNTIKIGIMDEERRTSANLKACIYAARERVFFINTGFLDRTGDEIHTSMEAGPVLLKDQI
KAERWIQAYEDRNVTIGIACGLTGRAQIGKGMWARPDDMAAMMEQKIGHPKSGANCAWVP
SPTAATLHALHYHEVDVFEAQKRRHNEPIPGLDALFSMPVLDPATLSAEQIQRELDNNAQ
GILGYVVRWVDAGVGCSKVPDINNVGLMEDRATCRISSQAIANWLWHGVVTQDEVVATFT
RMARVVDQQNAGDPAYEPMSGDPEHSIAFQAALALALQGVEQPSGYTEPLLHAKRAEKKA
QR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctatgtcacccgagccggtttgcaggtcgatgaacagcttgccgcgtttgtc
gagcaagaggcgctcaagggacccgatgtcgcttcggacaggttctgggcggggtttgcc
gagatggtcgcggcctatatgccgggcaatcgcgagctcctggaaatccgcgacaggatg
cagaaccagatcgacgactggcaccgcgacaatggcccggcaacagcgaacccggaggcc
tatcaggcgtttttgcgcgagatcagctatctcgaggacgagccggaggatttccggatc
gaaactgaaaatctcgatcccgagatcgcctcgatctgcggcccgcagcttgtcgtgccg
gtgtccaatgcgcgctatgcgctcaatgccgccaatgcgcgctggggcagtctctacgat
gcgttttacggcactgatgtgatcgcccgtgagggcgatctggcaccggggcgtcagtac
aatgccaagcgcggtgcggaagtgtttgcgcgggccgggcatttccttgacgaggcgttt
ccgttgctcggggtcaagcactgggccgtgacacgctatggcgtcgatatatcgggagat
gtcgccagactggtgattgaaagtcaggatggccgggcgaaactggcttatcccgaggcg
ttcgcgggctattcgcgcgatggcgatgtgctgcgcatcctgctcaagcaccacgggctg
catgtcgacctggtgatcgatcccaaccatccggtgggcaaggatcatccggccaatctg
gctgatgtggcgatcgaaagcgcgttgaccacaattcaggattgcgaggattcggttgcg
gcggtcgatgccgaggacaaggtcggggtctatcgcaactggctcgggctgatgaagggc
gatctggccgatacgttcgaaaagggcggcaagagtgtcacacggacgctcaatgcggat
cgggtttacacagcaccggatggaagcgagttgaccctgaaggggcgcgcattgctgctg
gtgcgcaatgtcgggcatctgatgaccaccgatgccattcttgacgctgaaggccagccg
atcggcgaggggctgatggatgcggcgatcaccacgctttgcgcgctgcacgaccgcaag
cggaaggccaattcaacaaccggctcgatttatatcgtcaagcccaagatgcacgggccg
accgaagtgctgtttgcgtgcaatgtgttcggggaagtggaaaaaatcctcgggctgccg
ctcaacaccatcaagatcggcatcatggacgaggagcgccggacctcggccaacctcaaa
gcgtgcatttatgcagcgcgtgaacgggtgttttttatcaacaccgggttcctcgaccgc
accggtgacgaaatccatacgtcgatggaagccgggccggtgctgctcaaggaccagatc
aaggccgaacggtggattcaagcctacgaggatcgcaacgtcacgatcggtattgcctgc
gggctgacgggccgcgctcagatcggcaagggcatgtgggcccggcccgacgatatggcg
gcgatgatggagcaaaagatcgggcatccgaaatcgggcgccaattgcgcctgggtgcct
tcgccgacggcggcaacgctgcacgcgctccactatcatgaggtcgacgtgttcgaggcg
caaaagcgccggcacaacgaacccattcccggtctggacgccttgttttccatgccggtg
cttgatcccgcgacgctctcggccgagcagatccagcgcgaactcgacaacaatgcgcaa
gggatcctgggctatgtggtgcgctgggtcgatgcgggggtggggtgttcgaaagtcccc
gacatcaacaatgtgggactgatggaagaccgggcgacctgccgcatttcatcgcaggcc
atcgccaactggctctggcatggggtggtgacccaggacgaggtggtggcgaccttcacc
cggatggcccgggtggtcgatcagcagaatgcgggtgatccagcctatgagcccatgagc
ggtgatcccgaacactcgattgcctttcaggccgcattggctttggcactgcaaggggtc
gaacagccttctggttataccgagccgctgttgcacgccaagcgggccgaaaagaaagct
caacgatag

DBGET integrated database retrieval system