KEGG   Pelagibacterium halotolerans: KKY_2324Help
Entry
KKY_2324          CDS       T01645                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00071  Fatty acid degradation
phl00280  Valine, leucine and isoleucine degradation
phl00310  Lysine degradation
phl00362  Benzoate degradation
phl00380  Tryptophan metabolism
phl00620  Pyruvate metabolism
phl00630  Glyoxylate and dicarboxylate metabolism
phl00640  Propanoate metabolism
phl00650  Butanoate metabolism
phl00900  Terpenoid backbone biosynthesis
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01120  Microbial metabolism in diverse environments
phl01130  Biosynthesis of antibiotics
phl01200  Carbon metabolism
phl01212  Fatty acid metabolism
phl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KKY_2324
   00630 Glyoxylate and dicarboxylate metabolism
    KKY_2324
   00640 Propanoate metabolism
    KKY_2324
   00650 Butanoate metabolism
    KKY_2324
  Lipid metabolism
   00071 Fatty acid degradation
    KKY_2324
   00072 Synthesis and degradation of ketone bodies
    KKY_2324
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KKY_2324
   00310 Lysine degradation
    KKY_2324
   00380 Tryptophan metabolism
    KKY_2324
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KKY_2324
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KKY_2324
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KKY_2324
Enzymes [BR:phl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KKY_2324
Exosome [BR:phl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KKY_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEQ52333
UniProt: G4R889
Position
complement(2313906..2315147)
Genome map
AA seq 413 aa AA seqDB search
MTRGLRLTFEDAWLLGGARTPFVDYRGALSEISPIDLGIKAARAAIAKTGVAAADIETTI
AGSMAQASFDAFMTPRHIGLYAGAPIEAPAHLVQRICGTGLEVIAQAADAVALGRVSLAL
AAGTESMSRNPIAAYTHRNGFTMGKVEFKDFLWEALYDPAGCVTMGDTAENLAKQYGIER
ERVDRFAVRSFERAIAARDGGLLAEEIVPVVSEAFEIEGIDKRSIRLPRGIEQVDTDSHI
RPSPYDILSKLRPAFGGVQTGGNSSAIVDGAGAVLVASSDYAKSHGLTPKARIVASAAVG
VPPQIMGIGPAPAIRAVLEASGLTLDRIGRIEINEAFGAQILACVDELGLDEDKLNVNGG
AIAIGHPLGATGIRLALTLANELERSGERYGIASACIGGGQGIALLIENPKAV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggggattgcgtcttacattcgaggatgcctggctgctcggcggggcacgcacc
ccgttcgtggactatcgcggcgcactttcggaaatttcgcccatcgatttaggcatcaag
gccgcccgcgcggctattgcgaaaaccggcgtggccgctgccgatatcgaaaccacgatt
gccggctccatggcccaggcatcgttcgatgcgttcatgacgccgcgccatatcgggctt
tacgccggcgcgcccatcgaggcgcccgcccatttggtacaacgcatctgcggcaccggg
ctcgaagtgatcgcccaggcagccgacgccgtcgctttggggcgcgtgagcctcgcgctg
gccgcgggcacggaatcgatgagccgcaatcccatcgccgcctatacgcatcgcaacggc
tttaccatgggcaaggtggagttcaaggatttcctctgggaagccctttatgatcccgcc
ggttgcgtcaccatgggcgacaccgccgaaaacctcgccaaacaatatggcatcgagcgc
gagcgcgtggaccgcttcgccgtgcgcagtttcgagcgggccatcgcggcgcgcgatggg
ggcctgctggccgaggaaattgttccggtggtcagcgaagccttcgagatcgaaggcatc
gacaaacgctccatacggttgccgcgtggtatcgaacaggtcgataccgacagccacatc
cgaccctcgccctacgacattctttccaaactgcgcccggccttcggcggtgtgcagacg
gggggcaattcgtcggccatcgtcgatggcgcgggtgctgtgctggtggcttcgtcggac
tatgccaaatcccatgggctcacgcccaaggcacgcattgttgcctcggcagcagtcggc
gtgccgccgcagatcatgggcatcggcccggcgcccgccattcgcgccgtgctcgaagca
agcgggctgacgctcgaccggatcggacgcatcgagatcaacgaggcattcggtgcccaa
atcctcgcctgcgtcgacgaattggggctcgatgaggacaagctcaatgttaatggtggc
gccatcgccatcgggcatccgctgggcgcgaccggcattcggctggcgctcacgcttgcc
aatgagttggaacggtccggcgaacgctacggcattgcctcggcctgcatcggcggcggg
caggggattgcgcttttgatcgaaaatccgaaggctgtctga

DBGET integrated database retrieval system