KEGG   Pelagibacterium halotolerans: KKY_2458Help
Entry
KKY_2458          CDS       T01645                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
phl  Pelagibacterium halotolerans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:phl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KKY_2458
Enzymes [BR:phl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     KKY_2458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2450986..2451603)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGIVETLGDDTALIDVNGVCYEAHCSGRTLQALPRVGEAAVLFIEMIVREDMIRL
YGFATEGEKSWFRLLMTVQGVGSRVALGILSILSPSDLSSAIALQDKAMVGRASGVGPKL
AQRIVSELKGKVPAGVSIDAGAMGLQTALVEGNASGNVSDAVSALVNLGYGQAQASSALA
RVVAKEGEDTPTEKLIRLGLRELSS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtaaactcaagggcatcgtcgaaacgctcggggacgacaccgcgctgatcgac
gtcaacggcgtgtgttacgaggctcattgttcggggcgcacgttgcaggctttgccgcgc
gttggtgaagcggccgtgctgtttatcgaaatgattgtgcgcgaggacatgatccggctc
tacggctttgccaccgagggcgaaaagagctggtttagactgttgatgaccgtccagggc
gtgggctcgcgcgtcgcgctgggcattctttcgatcctttcaccctccgatctgtcctct
gccatcgcgctgcaggacaaggccatggtgggccgcgcgtcgggggtcggccccaagctg
gcccagcgcatcgtctccgaactcaagggcaaggttcccgctggcgtatccatcgatgcc
ggagcgatgggccttcagaccgcgctggtcgagggcaacgcttcgggcaatgtttcggac
gccgtctcggcgctggtcaatctgggctacgggcaggcgcaggcatcgagcgcgctggca
cgggtggtggcgaaagagggcgaggacacgcccaccgaaaagctcatccggctggggttg
cgggaactatcctcgtga

DBGET integrated database retrieval system