KEGG   Pelagibacterium halotolerans: KKY_2525Help
Entry
KKY_2525          CDS       T01645                                 

Definition
(GenBank) alpha-subunit of fatty acid oxidation complex
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00071  Fatty acid degradation
phl00280  Valine, leucine and isoleucine degradation
phl00281  Geraniol degradation
phl00310  Lysine degradation
phl00362  Benzoate degradation
phl00380  Tryptophan metabolism
phl00410  beta-Alanine metabolism
phl00640  Propanoate metabolism
phl00650  Butanoate metabolism
phl00903  Limonene and pinene degradation
phl00930  Caprolactam degradation
phl01040  Biosynthesis of unsaturated fatty acids
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01120  Microbial metabolism in diverse environments
phl01130  Biosynthesis of antibiotics
phl01200  Carbon metabolism
phl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KKY_2525
   00650 Butanoate metabolism
    KKY_2525
  Lipid metabolism
   00071 Fatty acid degradation
    KKY_2525
   01040 Biosynthesis of unsaturated fatty acids
    KKY_2525
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KKY_2525
   00310 Lysine degradation
    KKY_2525
   00380 Tryptophan metabolism
    KKY_2525
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KKY_2525
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KKY_2525
   00281 Geraniol degradation
    KKY_2525
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KKY_2525
   00930 Caprolactam degradation
    KKY_2525
Enzymes [BR:phl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KKY_2525
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KKY_2525
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KKY_2525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA UDPG_MGDP_dh_N Pyr_redox_2 AlaDh_PNT_C Methyltransf_31 ThiF
Motif
Other DBs
NCBI-ProteinID: AEQ52533
UniProt: G4RA06
Position
complement(2515253..2517220)
Genome map
AA seq 655 aa AA seqDB search
MEQADTPQTRHWDFSIDVEQIGWLTLNVQDNSVNVLSREVISELEALVGHVERLGEAGSL
VGVVLLSGKPGFIAGADISEFDQMSDPAVLPEALRRTHGVFQRIEDLKIPFVCGISGFCV
GGGLELALACHYRIAVNDDATKLGFPEVNLGIFPGFAGTGRSIRQAGPVDAMQLMLTGKI
LRAAQARKLNLVDKLVRHPDMLRWEGRKAVLSRRRSDPAPLTKRAIAFGPIRSRVADKMR
EEAGKKAPKNHYPAPYALIDLFEKYGDDPKKMIAHEIDSFVPLMASPTAQNLRRVFFLSE
SLKRLGVKGKDKPKFVRVHVVGAGVMGGDIAAWCAYRGMAVTLQDMDMDRIKPALDRAKK
LFKKRLKTKQAVDAAMARLEPDVEGKGIARCDVLIEAVVEKLEVKQQIFSNAEQQLKPNA
IMATNTSSIELERIAEALDNPNRLIGLHFFNPVAQLPLIEVIRSTLNDDEAIRVGASFVL
AIGKSPVVVKSAPGFLVNRALMPYMLEAIDRVEKGESPEQLDAAAVAFGMPMGPIELMDT
VGLDVGAFVARELGQKVPEDSKFARLVAAGKLGRKTGQGFYTWVDGKAQKEKAPAHANLE
GLGRDLVQPLVDTAEVIVSEGVVESADMADIGMILGTGFAPFLGGPLKAREDGRA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
ttggagcaagctgatacgccgcaaacccgacactgggacttttcaatcgatgtcgagcag
atcggctggctgacgctgaacgttcaggacaattcggtcaacgtcctcagccgggaggtg
atttccgagctcgaagcgctggtcggccatgtcgaacgtctgggcgaggcgggcagcctt
gtgggcgtcgtcctgctttcgggaaagcccggctttatcgctggtgccgacatttccgaa
ttcgaccagatgagcgacccggccgttctccccgaagcgctgcgacggacccatggggtg
ttccagcggatcgaggatctcaaaatcccgttcgtgtgcggcatttcgggtttctgcgtg
gggggcggtctggaactggcgcttgcgtgccactatcgcattgcggtcaatgacgatgcg
accaagctgggctttcccgaagtcaatcttgggattttcccaggctttgcaggaaccggg
cgctcgatccgtcaggccgggccggtcgatgccatgcaattgatgctgacgggcaagata
ttgcgcgccgcgcaggcgagaaaactcaaccttgtcgacaagctggtgcgtcatcccgac
atgctgcgttgggagggccgcaaggcggtgctgtcgaggcgcagatccgatcccgcgccc
ttgaccaagcgcgccatagcgttcgggccgatccgttcgcgcgttgccgacaagatgcgc
gaggaagcgggcaagaaggcgccgaaaaatcactatcccgcgccctatgcgctgatcgac
ctgttcgaaaaatatggcgacgatcccaaaaagatgatcgcccacgagatcgattccttt
gtgccgctgatggcttcgccgactgcgcaaaacctgcgccgggtcttctttttgtccgaa
agcctgaaacggctcggggtcaagggcaaggacaagcccaaatttgtccgcgtccatgtg
gtgggagccggggtgatgggtggtgacattgcggcctggtgcgcctatcgcggcatggcg
gtgacgctccaggatatggatatggaccgcatcaagccggcgctcgaccgggccaaaaaa
ctgttcaaaaagagactgaagaccaaacaggcggtcgatgccgccatggcgcggctggag
cctgacgtcgagggcaaaggaattgcccggtgcgacgtgctgatcgaggccgtggtggaa
aagctcgaggtcaagcagcagatcttttccaatgccgaacaacaacttaagcccaatgcg
atcatggcgaccaatacctcctcaatcgaactcgagcggatcgccgaagcgctggacaat
cccaacaggctgatcggattgcatttcttcaacccggtggcgcaattgccgctaattgaa
gtgatcagatcgacgctgaatgacgacgaggcgatccgggtgggggcgtctttcgtcctt
gccatcggcaagagcccggtggtggtcaaatccgcgccgggatttttggtcaaccgggcg
ctcatgccctacatgctcgaagccatcgaccgggtcgaaaagggcgaaagccccgaacag
ctcgatgcggcggcggtcgccttcggcatgcccatgggacccatcgaattgatggatacc
gtggggctcgacgtcggggccttcgttgccagggaactggggcagaaagtgcccgaggat
agcaagtttgcaagactggttgccgccgggaagctgggccgcaagaccggtcagggattt
tacacctgggttgacggcaaggcgcaaaaggaaaaggcgcccgcgcatgcaaatctcgaa
gggctggggcgtgatcttgtccagccgcttgtcgacaccgcagaagttatcgtttccgag
ggcgtggtcgaaagcgccgacatggccgacatcggcatgatcctggggaccgggttcgca
ccgttcctgggcggaccgctcaaggcacgcgaggacggaagggcttaa

DBGET integrated database retrieval system