KEGG   Pelagibacterium halotolerans: KKY_2627Help
Entry
KKY_2627          CDS       T01645                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KKY_2627
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KKY_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2628803..2629735
Genome map
AA seq 310 aa AA seqDB search
MVGRIVVIGSNMIDLVTYARRMPERGETLEAERFQSGFGGKGANQAVAAALLGSEVAMIG
RVGDDDFATGTLANFVRHGIDATHVARVPGVASGVAPILVEPGGENRILIAPGANAHLLP
EDLLPARGLVEGAALAIFQLEIRTATVLAGLEMARKAGVATLLNPAPAPDGPLPEGMLGL
VDHLVLNQSELAILSGLAPDAEIDVIDAANGLLARGVGRVVVTLGARGARLVGPEGVAVI
APVPVTALDTTGAGDAFIGAFAHFLVSGSSLETALAAASRYAALSVTRPGTQSSYADRAS
FARFSAGAAG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggttgggcggatcgtcgtcatcggcagcaacatgatcgatctcgtgacctatgcgcgg
cgcatgccggagcggggcgagacgctggaggccgaacgcttccagagcgggttcggcggc
aagggcgccaaccaggcggtggcggcggcgctgctgggttcggaggtcgcgatgatcggg
cgggtgggcgatgatgatttcgccaccggcacgctcgccaattttgtccggcacgggatc
gatgcgacccatgtggcgcgggtgccgggggtggcgagcggggtcgcgccgatcctcgtc
gagccgggcggggagaaccgcatcctcatcgcgccgggcgcgaatgcgcatctgctgccc
gaggatctcctgccggcgcgcgggctcgtcgaaggcgcagcgcttgcgatcttccagctc
gagatccgcaccgcgacggtgctcgccggtctcgaaatggcgcggaaggccggggttgcg
acgctgctgaacccggcgcccgcgccggacggtccgctgcccgagggcatgctcgggctc
gtcgaccacctcgtgctcaaccagagcgaactcgccattctctcgggccttgcgcccgac
gccgagatcgacgtgatcgatgcggccaacgggctgctggcgcgcggggtcgggcgggtg
gtggtgacgctgggcgcgcgcggggcgcggctcgtcgggcccgaaggcgtcgcggtgatc
gccccggtgccggtcacggcgctcgacacgacgggggcgggcgacgcgttcatcggggcc
ttcgcccatttcctcgtttcgggcagttcgctcgaaacggcgcttgcggcggcgagtcgg
tatgccgcgctttcggtgacgcggccgggaacgcaatcgtcctatgcggacagagcgagc
tttgcgcggttttcggcaggcgcggcgggctag

DBGET integrated database retrieval system