KEGG   Pelagibacterium halotolerans: KKY_2717Help
Entry
KKY_2717          CDS       T01645                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KKY_2717
   00052 Galactose metabolism
    KKY_2717
   00500 Starch and sucrose metabolism
    KKY_2717
   00520 Amino sugar and nucleotide sugar metabolism
    KKY_2717
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KKY_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720996..2721892
Genome map
AA seq 298 aa AA seqDB search
MVQRVRTAVFPVAGLGTRFLPATKAMPKEMLTVVDKPVIQYAVDEAREAGIEHFVFVTGR
NKGVIEDHFDRQFELEATLEARGKTAALEQLRRDLPRAGQSSFTRQQEPLGLGHAVWCAR
DIVGREPFALLLPDMIFKSSPGVLKQMMDTYEESGGNIIAVEECAPEDVSSYGVIARGEG
PDKGFAITGMVEKPKPEDAPSNLIISGRYILQPEIFSLLGEQTVGAGGEIQITDAMRYLM
DRQPFIGVKYDGQVFDCGSKIGFLTANVAFALDRPDIADAFLSELKTLTGDTPINIED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggtccagagagtccgtacagcagtctttcccgtcgccggccttggaacaaggtttctt
cccgccaccaaggccatgccaaaggagatgctgacggtcgtcgacaagcccgtcatccaa
tacgcggtcgacgaagcccgcgaggcgggcatcgagcatttcgttttcgtcaccggccgc
aacaagggcgtcatcgaggaccatttcgaccgtcagttcgaactcgaagccacactggaa
gcccgcggcaagaccgcggccctcgaacagcttcgccgcgatctccccagggccggccaa
tcgagcttcacccgccagcaggagccgctgggcttgggccacgccgtctggtgcgcccgc
gacatcgtcgggcgcgaacccttcgcgctgctcctgcccgacatgatcttcaaatcctct
cccggcgtcctcaagcagatgatggacacctacgaggaatcgggcggcaacatcatcgcc
gtcgaggaatgcgcgcctgaagacgtctcctcatatggcgtgatcgcccgcggcgaaggc
cccgacaagggcttcgccatcaccggcatggtcgaaaagcccaaacccgaggacgcaccc
tccaacctcatcatttcgggccgctacatcctgcagccggaaatcttctcgctcctgggc
gaacagacagtgggcgccggcggtgaaatccagatcaccgacgccatgcgctatctcatg
gaccgccagcccttcatcggcgtcaaatacgatggacaggtcttcgattgcggctccaag
atcggttttctgaccgccaacgtcgctttcgcgctcgatcggcccgatattgccgatgca
tttctgagcgaactcaagaccctgaccggcgataccccgatcaatattgaagactga

DBGET integrated database retrieval system