KEGG   Pelagibacterium halotolerans: KKY_2717Help
Entry
KKY_2717          CDS       T01645                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KKY_2717
   00052 Galactose metabolism
    KKY_2717
   00500 Starch and sucrose metabolism
    KKY_2717
   00520 Amino sugar and nucleotide sugar metabolism
    KKY_2717
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KKY_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720996..2721892
Genome map
AA seq 298 aa AA seqDB search
MVQRVRTAVFPVAGLGTRFLPATKAMPKEMLTVVDKPVIQYAVDEAREAGIEHFVFVTGR
NKGVIEDHFDRQFELEATLEARGKTAALEQLRRDLPRAGQSSFTRQQEPLGLGHAVWCAR
DIVGREPFALLLPDMIFKSSPGVLKQMMDTYEESGGNIIAVEECAPEDVSSYGVIARGEG
PDKGFAITGMVEKPKPEDAPSNLIISGRYILQPEIFSLLGEQTVGAGGEIQITDAMRYLM
DRQPFIGVKYDGQVFDCGSKIGFLTANVAFALDRPDIADAFLSELKTLTGDTPINIED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggtccagagagtccgtacagcagtctttcccgtcgccggccttggaacaaggtttctt
cccgccaccaaggccatgccaaaggagatgctgacggtcgtcgacaagcccgtcatccaa
tacgcggtcgacgaagcccgcgaggcgggcatcgagcatttcgttttcgtcaccggccgc
aacaagggcgtcatcgaggaccatttcgaccgtcagttcgaactcgaagccacactggaa
gcccgcggcaagaccgcggccctcgaacagcttcgccgcgatctccccagggccggccaa
tcgagcttcacccgccagcaggagccgctgggcttgggccacgccgtctggtgcgcccgc
gacatcgtcgggcgcgaacccttcgcgctgctcctgcccgacatgatcttcaaatcctct
cccggcgtcctcaagcagatgatggacacctacgaggaatcgggcggcaacatcatcgcc
gtcgaggaatgcgcgcctgaagacgtctcctcatatggcgtgatcgcccgcggcgaaggc
cccgacaagggcttcgccatcaccggcatggtcgaaaagcccaaacccgaggacgcaccc
tccaacctcatcatttcgggccgctacatcctgcagccggaaatcttctcgctcctgggc
gaacagacagtgggcgccggcggtgaaatccagatcaccgacgccatgcgctatctcatg
gaccgccagcccttcatcggcgtcaaatacgatggacaggtcttcgattgcggctccaag
atcggttttctgaccgccaacgtcgctttcgcgctcgatcggcccgatattgccgatgca
tttctgagcgaactcaagaccctgaccggcgataccccgatcaatattgaagactga

DBGET integrated database retrieval system