KEGG   Pelagibacterium halotolerans: KKY_28Help
Entry
KKY_28            CDS       T01645                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KKY_28
Enzymes [BR:phl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     KKY_28
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28514..29833
Genome map
AA seq 439 aa AA seqDB search
MTLLPQETIARKRDGKELSQAEIFAFVAGLTSGTVNDAQAAAFAMAVYFQNMTLDERVAL
TLAMRDSGRVLDWSDLDGPTIDKHSTGGVGDNVSLMLAPILAACGAYVPMISGRGLGHTG
GTLDKFDSIPGYMTNPDIDTLRRVVKRVGCAIISQTDDLAPADRRLYSIRDVTATVEDVS
LITASILSKKLAAGLDALILDVKSGSGAFMKTLDDSMGLAESLVSVANGAGLKTGALITD
MNQPLASAAGNWLEGKNAIDFLTGSHRDPRLQEVTLALCAHGLVLGGMALDYDDGFIRAK
IALDSGAAAEKFFAMANALGSWHDLEKYVPGPVGVVREVHPVSIGRVAHIDVRGVGMAVV
VLGGGRTDPSQKIDYHVGFDRLAGIGTKVDPQTPIARIHARDEATAAEAEKRLLAAYTID
EDTPEHPVIYSEISPKGGQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgacccttctccctcaagaaaccatcgcccgaaaacgcgatggcaaagaattgtcgcag
gccgagattttcgccttcgtcgccgggctcacctcgggcaccgtcaacgacgcgcaggcc
gccgcctttgccatggccgtctatttccagaacatgactcttgatgagcgcgtggcttta
accctcgccatgcgcgattcaggccgcgtgctcgattggtccgatctcgatggccccacc
attgacaagcactcgaccggcggagtgggcgacaacgtctcattgatgcttgcgccgatc
ctggccgcctgcggcgcttacgtcccgatgatttccggacgtggcctcgggcacaccggt
ggcacgctcgacaagttcgattccatccccggctacatgaccaatcccgacatcgacacg
ctgcgccgggtggtcaagcgtgtcggctgtgccattatcagccagacagacgatctcgcc
ccggccgaccggcggctctattccatccgcgacgtcaccgcgaccgtcgaggacgtctcg
ctcatcaccgcatcgatcctctccaaaaagctcgccgccgggctcgatgcactcatcctc
gacgtcaagtctggttcgggtgctttcatgaagaccctcgacgactccatggggctggcc
gaaagcctcgtttcagtcgccaatggcgcgggtttgaaaactggcgcgctcatcaccgac
atgaaccagccgctcgcctctgcggcgggcaattggctcgagggcaaaaacgccatcgat
tttctcaccggctcccatcgcgacccgcgcctccaagaggtaacgctcgccctttgcgcc
cacggacttgtcctcggcggcatggcactcgattatgatgacgggtttatccgcgcaaag
attgcactcgacagtggtgcagccgccgagaagttttttgccatggcgaatgcgctaggg
tcctggcacgatttggaaaaatatgtgcccggtccagtgggcgtggtaagggaagtgcac
ccagtgtccattgggcgtgtagcccatatcgatgtgcgcggcgtgggcatggcggtggtc
gttctgggaggaggccgcaccgacccgagccagaagatcgactatcacgtgggctttgat
cgcctcgccggcatcggcacgaaagtcgatccccaaacccccatcgcccgcatccacgcc
cgcgacgaggccactgccgcggaagccgaaaagcggctgctggcggcctacacaatcgac
gaggatacgccagaacatcctgttatctatagtgaaatttcgcccaagggaggccagtga

DBGET integrated database retrieval system