KEGG   Pelagibacterium halotolerans: KKY_2926Help
Entry
KKY_2926          CDS       T01645                                 

Definition
(GenBank) endo-1,4-beta-glucanase
Organism
phl  Pelagibacterium halotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2918396..2919439
Genome map
AA seq 347 aa AA seqDB search
MNIDLLRALCETPGVPGREHRVRKLIETEIEGLFDEVRTDSMGSLIAVRKSRTKAKNPLK
IMLLCHMDEIGFLVTHVSEKGWIHIDNVGGFDPRTLFARRVKVVTPDGDYPGVMNAGGRP
LHISSPEDRKKIPAIKEFFVDIGFGAETREKVRVGDFIVMDEPLIEMGEKIVSKALDNRV
ACWLGIEAIRALAESGVDHECEIHVAFTTQEEVGLRGARTAAFAVSPDIGLGIDTTLACD
TPGVPENEMVTAQGKGVGLTIKDGSFIADFDLVEEIEALAKKQDIPVQRSILASGGQDAA
AAQQAAAGARAIGIVVGTRYIHTVAEMIEKSDLKAALDILVAYLKGK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgacctgctgcgcgccttgtgcgaaacccccggcgtccccggccgcgaacac
cgcgtgcgcaaactgatcgaaaccgaaatcgaaggccttttcgatgaggtcagaaccgat
tccatgggctcgctgattgccgtacgcaaatcgcgcaccaaagccaaaaacccgctgaaa
atcatgctgctctgccacatggacgagatcgggttcctggtcacccatgtgtccgaaaag
ggctggatccacatcgacaatgtcggcggcttcgatccgcgcaccctgttcgcacgccgc
gtcaaggtcgttacccccgatggcgattacccaggcgtcatgaacgccggcgggcgtccg
ctgcacatatcatcgcccgaagatcgcaagaagatccccgccatcaaggagttcttcgtc
gatatcggtttcggcgccgagacccgcgagaaagtccgggtcggcgatttcatcgtcatg
gacgagccgctcatcgaaatgggcgaaaagatcgtctccaaggccctcgacaaccgtgtc
gcctgctggctgggcatcgaggccatccgcgccctcgccgaaagcggggtcgaccatgag
tgcgaaatccacgtcgccttcaccacgcaggaagaagtgggcctgcgcggcgcccgcacc
gccgccttcgccgtttcacccgatatcgggctcggtatcgatacgacgctggcctgcgat
acgccgggcgtgcccgaaaacgaaatggtcaccgcccagggcaagggcgttggcctgacc
atcaaggatggctcgttcatcgccgatttcgatctggtcgaggagatcgaggcgctggcc
aaaaaacaagatatccccgtccagcgctccatcctcgcttcgggcggacaggacgccgcc
gccgcccagcaggccgccgccggcgcccgcgccatcggcatcgtggtgggcacccgctat
atccacacggtcgccgaaatgatcgaaaaatccgacctcaaggcggccctcgatattctc
gtcgcctacctcaagggcaaataa

DBGET integrated database retrieval system