KEGG   Pelagibacterium halotolerans: KKY_2926Help
Entry
KKY_2926          CDS       T01645                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
phl  Pelagibacterium halotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KKY_2926
Enzymes [BR:phl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KKY_2926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2918396..2919439
Genome map
AA seq 347 aa AA seqDB search
MNIDLLRALCETPGVPGREHRVRKLIETEIEGLFDEVRTDSMGSLIAVRKSRTKAKNPLK
IMLLCHMDEIGFLVTHVSEKGWIHIDNVGGFDPRTLFARRVKVVTPDGDYPGVMNAGGRP
LHISSPEDRKKIPAIKEFFVDIGFGAETREKVRVGDFIVMDEPLIEMGEKIVSKALDNRV
ACWLGIEAIRALAESGVDHECEIHVAFTTQEEVGLRGARTAAFAVSPDIGLGIDTTLACD
TPGVPENEMVTAQGKGVGLTIKDGSFIADFDLVEEIEALAKKQDIPVQRSILASGGQDAA
AAQQAAAGARAIGIVVGTRYIHTVAEMIEKSDLKAALDILVAYLKGK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgacctgctgcgcgccttgtgcgaaacccccggcgtccccggccgcgaacac
cgcgtgcgcaaactgatcgaaaccgaaatcgaaggccttttcgatgaggtcagaaccgat
tccatgggctcgctgattgccgtacgcaaatcgcgcaccaaagccaaaaacccgctgaaa
atcatgctgctctgccacatggacgagatcgggttcctggtcacccatgtgtccgaaaag
ggctggatccacatcgacaatgtcggcggcttcgatccgcgcaccctgttcgcacgccgc
gtcaaggtcgttacccccgatggcgattacccaggcgtcatgaacgccggcgggcgtccg
ctgcacatatcatcgcccgaagatcgcaagaagatccccgccatcaaggagttcttcgtc
gatatcggtttcggcgccgagacccgcgagaaagtccgggtcggcgatttcatcgtcatg
gacgagccgctcatcgaaatgggcgaaaagatcgtctccaaggccctcgacaaccgtgtc
gcctgctggctgggcatcgaggccatccgcgccctcgccgaaagcggggtcgaccatgag
tgcgaaatccacgtcgccttcaccacgcaggaagaagtgggcctgcgcggcgcccgcacc
gccgccttcgccgtttcacccgatatcgggctcggtatcgatacgacgctggcctgcgat
acgccgggcgtgcccgaaaacgaaatggtcaccgcccagggcaagggcgttggcctgacc
atcaaggatggctcgttcatcgccgatttcgatctggtcgaggagatcgaggcgctggcc
aaaaaacaagatatccccgtccagcgctccatcctcgcttcgggcggacaggacgccgcc
gccgcccagcaggccgccgccggcgcccgcgccatcggcatcgtggtgggcacccgctat
atccacacggtcgccgaaatgatcgaaaaatccgacctcaaggcggccctcgatattctc
gtcgcctacctcaagggcaaataa

DBGET integrated database retrieval system