KEGG   Pelagibacterium halotolerans: KKY_3068Help
Entry
KKY_3068          CDS       T01645                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
phl  Pelagibacterium halotolerans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:phl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:phl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3040533..3041582)
Genome map
AA seq 349 aa AA seqDB search
MSNIRVLVVDDSALIRDVLSKTLAQEGDITVVGTAHDPLDARDKIKALNPDVVTLDIEMP
NMNGLAFLQKIMRLRPLPVVMVSTLTTKGASETMLALELGAVDFVAKPGTEMAGGLEAFG
ATLREKVRFAAQSDVQARAHRAQAPDLPLKTAAAPQGALIAIGASTGGVEAIRQVLSSIP
ADCPPIVIAQHMPKGFTARFSARLNELVPVRVIEAADRMVLERGTAYVAPGDFHLRVEKT
SGQLKCRVTQDEQTSGHRPSVDVLFSSVAKVVGSMAVGAILTGMGRDGAAGLKAMREAGA
FTIGQSQGSALIYGMPKVAFEMGAVTEEAPVEKIAGRLVSALMKLKAAA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcagggtcctcgtcgtcgacgattcggcgctcattcgggacgtgctttcc
aaaacgctggcgcaggagggcgatatcaccgtggtgggcacggcgcatgatccgctcgat
gcgcgcgacaagatcaaggcactcaatcccgatgtcgtgacgctcgatattgaaatgccc
aacatgaacggcctggcctttctgcaaaagatcatgcggctgcggcccctgccggtggtg
atggtttccacgctaaccacgaaaggtgcgtccgaaaccatgctggcgctggagctgggt
gctgtcgatttcgtcgccaagcccggcaccgagatggcgggcgggctcgaagcgttcggt
gcgaccttgcgtgagaaggtgcgctttgcggcgcaatcggacgtgcaggctcgggcccat
cgcgcccaggcaccggacctgccgctcaagacggcggcggcgcctcagggggcactgatc
gcgattggcgcgtcgacaggtggcgtcgaggccatccggcaggtgctctcatcgatcccc
gccgattgtccacctatcgtcattgcccaacacatgccaaaggggttcactgcgcgcttt
tccgcccggctcaacgagcttgtgccggtgcgggtgatcgaggccgctgaccggatggtg
ctcgagcggggcacggcctatgtcgcgcccggggatttccatctgcgggtggaaaagacg
tcgggccagctcaaatgccgggtgacccaggatgaacaaacctctggccatcgaccgagc
gtggacgtgcttttcagttcagtggccaaggtggtgggctccatggcagtcggggcgatc
ctgaccggcatggggcgcgatggggccgcgggcctaaaggccatgcgcgaagctggcgcg
ttcaccatcggacaatcccaaggatccgcgctgatctatggcatgcccaaggtggcgttc
gagatgggcgcggtgaccgaggaagctccggtggaaaagatcgccgggcggctggtcagc
gctctcatgaagctcaaggccgcagcttga

DBGET integrated database retrieval system