KEGG   Pelagibacterium halotolerans: KKY_3130Help
Entry
KKY_3130          CDS       T01645                                 

Definition
phosphomannomutase
Orthology
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
phl  Pelagibacterium halotolerans
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KKY_3130
   00520 Amino sugar and nucleotide sugar metabolism
    KKY_3130
Enzymes [BR:phl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     KKY_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3106461..3107849)
Genome map
AA seq 462 aa AA seqDB search
MRGLSEGFTRELVFAHVGGFLETACTGARSREVALGRDLRASSPQIAALVGGALGALGWT
PINAGAVPTPALAAYALERGIPAIMVTGSHIPAAYNGLKFYRPDGELLKSDEEPIRTGAR
MLSEAVPEFDPFLPKEDPGAYQEYEKRYLTAFSQTALAGLKVAVFEHSSVGRDLLFHVLE
ALGASCTSVGRSEAFVAVDTEAVEPSAMAQIQAALATGEFDAVVSMDGDGDRPLLVDAKG
NQISGDVLGALTARFLGAKSVVTPLTSTSALEQSTWFGTVRRTRIGSPYVVEEMAGQGRD
GTVGFEANGGFLLEGDFALAHGRLKRLPTRDALLPIIAVLTEAVARDLPIGDLVAELPVR
VMRADRLKDVKPDDARKLVEDLAQSSTLRASFDPSLATPDTIDTTDGTRLITARGDIVHF
RRSGNAPELRCYVETGSAESTQTMLSTMIARLTTHLNAKGLQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgagggggctctcggagggctttacccgcgaactggtttttgcccatgtcggggggttt
ttggaaaccgcctgtactggcgcccgtagccgggaggtcgcgctgggccgcgacctgcgc
gcgtccagtccccaaatcgccgcgttggtcggcggggcgctcggtgccctgggctggacg
ccgatcaatgccggagccgtgcccacgccggcacttgcggcctatgccctcgagcgcggc
attcccgccatcatggtgaccggcagccacattcccgccgcctataacgggctcaaattc
tatcgtcccgacggtgagttgctcaagagcgacgaggagcccatcaggaccggtgccagg
atgctttccgaggccgtgcctgaatttgatcctttcctgccgaaagaagatccgggcgcc
tatcaggagtacgaaaagcgctacctgactgcattttctcaaaccgcgttggcggggttg
aaagttgccgtattcgagcattcgtcggttggacgggatttacttttccatgttctcgag
gcgctcggtgcatcgtgcaccagcgtgggacggagcgaggctttcgttgctgtcgatacc
gaagcggtcgaaccctcggccatggcgcagattcaggctgcgctggctacaggcgaattt
gacgccgtggtctcgatggatggtgacggcgaccgcccattgcttgtggatgcgaagggc
aatcaaatcagcggcgatgttctgggagcgctcaccgcgcggtttcttggagcgaaatcg
gtggtcactccgctcacctcgaccagcgcgctcgaacagagcacgtggtttggaacggtg
cggcggacacggatcggatcgccatatgtggtcgaggaaatggccgggcagggtcgggat
gggaccgttgggttcgaggccaatggcggctttctccttgaaggcgatttcgcgcttgcg
cacggccggctcaaacgcctgccgacacgtgatgcgctgctgcccattatcgctgtcctg
accgaggcagtcgcccgcgatctgccgattggcgatctggttgccgaactgccagttcgc
gtcatgagggcagatcggctgaaggacgttaaacccgacgatgcgcggaaacttgtagag
gatctcgcgcagtcgagcacgctgcgggccagtttcgatccaagccttgccacccccgat
acgatcgacacgaccgatggcacgagactcattaccgcccggggggacatcgtccacttc
cggcggtccggcaatgcccccgagctcagatgttatgtcgagaccggaagtgccgaatcc
acacaaaccatgctctccaccatgatcgccagactgacgacacatttgaacgcgaagggg
ctccaatga

DBGET integrated database retrieval system