KEGG   Pelagibacterium halotolerans: KKY_3130Help
Entry
KKY_3130          CDS       T01645                                 

Definition
(GenBank) phosphomannomutase
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00051  Fructose and mannose metabolism
phl00520  Amino sugar and nucleotide sugar metabolism
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KKY_3130
   00520 Amino sugar and nucleotide sugar metabolism
    KKY_3130
Enzymes [BR:phl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     KKY_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEQ53120
UniProt: G4RGW7
Position
complement(3106461..3107849)
Genome map
AA seq 462 aa AA seqDB search
MRGLSEGFTRELVFAHVGGFLETACTGARSREVALGRDLRASSPQIAALVGGALGALGWT
PINAGAVPTPALAAYALERGIPAIMVTGSHIPAAYNGLKFYRPDGELLKSDEEPIRTGAR
MLSEAVPEFDPFLPKEDPGAYQEYEKRYLTAFSQTALAGLKVAVFEHSSVGRDLLFHVLE
ALGASCTSVGRSEAFVAVDTEAVEPSAMAQIQAALATGEFDAVVSMDGDGDRPLLVDAKG
NQISGDVLGALTARFLGAKSVVTPLTSTSALEQSTWFGTVRRTRIGSPYVVEEMAGQGRD
GTVGFEANGGFLLEGDFALAHGRLKRLPTRDALLPIIAVLTEAVARDLPIGDLVAELPVR
VMRADRLKDVKPDDARKLVEDLAQSSTLRASFDPSLATPDTIDTTDGTRLITARGDIVHF
RRSGNAPELRCYVETGSAESTQTMLSTMIARLTTHLNAKGLQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgagggggctctcggagggctttacccgcgaactggtttttgcccatgtcggggggttt
ttggaaaccgcctgtactggcgcccgtagccgggaggtcgcgctgggccgcgacctgcgc
gcgtccagtccccaaatcgccgcgttggtcggcggggcgctcggtgccctgggctggacg
ccgatcaatgccggagccgtgcccacgccggcacttgcggcctatgccctcgagcgcggc
attcccgccatcatggtgaccggcagccacattcccgccgcctataacgggctcaaattc
tatcgtcccgacggtgagttgctcaagagcgacgaggagcccatcaggaccggtgccagg
atgctttccgaggccgtgcctgaatttgatcctttcctgccgaaagaagatccgggcgcc
tatcaggagtacgaaaagcgctacctgactgcattttctcaaaccgcgttggcggggttg
aaagttgccgtattcgagcattcgtcggttggacgggatttacttttccatgttctcgag
gcgctcggtgcatcgtgcaccagcgtgggacggagcgaggctttcgttgctgtcgatacc
gaagcggtcgaaccctcggccatggcgcagattcaggctgcgctggctacaggcgaattt
gacgccgtggtctcgatggatggtgacggcgaccgcccattgcttgtggatgcgaagggc
aatcaaatcagcggcgatgttctgggagcgctcaccgcgcggtttcttggagcgaaatcg
gtggtcactccgctcacctcgaccagcgcgctcgaacagagcacgtggtttggaacggtg
cggcggacacggatcggatcgccatatgtggtcgaggaaatggccgggcagggtcgggat
gggaccgttgggttcgaggccaatggcggctttctccttgaaggcgatttcgcgcttgcg
cacggccggctcaaacgcctgccgacacgtgatgcgctgctgcccattatcgctgtcctg
accgaggcagtcgcccgcgatctgccgattggcgatctggttgccgaactgccagttcgc
gtcatgagggcagatcggctgaaggacgttaaacccgacgatgcgcggaaacttgtagag
gatctcgcgcagtcgagcacgctgcgggccagtttcgatccaagccttgccacccccgat
acgatcgacacgaccgatggcacgagactcattaccgcccggggggacatcgtccacttc
cggcggtccggcaatgcccccgagctcagatgttatgtcgagaccggaagtgccgaatcc
acacaaaccatgctctccaccatgatcgccagactgacgacacatttgaacgcgaagggg
ctccaatga

DBGET integrated database retrieval system