KEGG   Pelagibacterium halotolerans: KKY_3234Help
Entry
KKY_3234          CDS       T01645                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
phl  Pelagibacterium halotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KKY_3234
Enzymes [BR:phl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KKY_3234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3215930..3216673
Genome map
AA seq 247 aa AA seqDB search
MADRRSVLVTRPRADAERTAAGLSALGLDPIIAPMLEERFTGVALPDADGFAAIALTSAN
GVRALAAHPRGEAFSALRVYAVGEHTAAEARAAGFDHVSAAEGTLADLARTIIADRPSGK
ILYPAAHHQSGDLAGLMAEAGIDVDMRVLYEMHAATALPPGLAERLATGKIDGAVFYSRR
TAEIFAGLVAARDYGELRTRLYCLCLSENVAQPLIESHFLRIGLADYPSHEAMMTLALAF
ARDQISP
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccggcgcagcgtactggtcacccggccaagggccgatgccgagcggacggcc
gccgggctttccgccctggggctcgacccgatcattgccccaatgctcgaggagcgcttc
accggtgtcgcgctgcccgatgccgatggtttcgccgccattgctctgacatcggccaat
ggcgtgcgggccctggccgcccacccgcggggcgaggcgttttcggcgctcagggtctat
gccgtgggcgagcacacggccgccgaggcgcgcgccgccgggttcgatcacgtctcggcc
gccgagggcaccctcgccgatctcgcccggacgatcatcgccgaccgcccttcgggaaaa
atcctttatcccgcagcgcaccatcagtcgggcgatctggccggactgatggccgaggcg
gggatcgatgtggacatgcgtgtgctctacgaaatgcacgccgccacagcgctgccaccg
gggctggccgaacgcctggcgacgggaaagatcgacggggcggtgttctactcccggcgc
accgcggaaattttcgcggggctcgtggccgcgcgcgactatggagagctcaggacccgc
ctttactgcctttgtctttccgaaaatgtcgcccagcccttgatcgaaagccatttcctg
cgcatcgggctggccgattatccctcgcacgaagcaatgatgaccctggcgctggctttt
gcccgcgatcaaatcagtccatga

DBGET integrated database retrieval system