KEGG   Pelagibacterium halotolerans: KKY_3387Help
Entry
KKY_3387          CDS       T01645                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KKY_3387
   00051 Fructose and mannose metabolism
    KKY_3387
Enzymes [BR:phl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     KKY_3387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3355728..3357035)
Genome map
AA seq 435 aa AA seqDB search
MSDFFKGLSKVRYEGPNSDNPLAFHHYNPDEIVMGKRMEEHLRFAIAYWHSFAWEGGDPF
GGRTFERPWFDGGMDAAKLKADVAFELFTLLGAPYFCFHDADVRPEGESFAESRKRLEAL
ADIFENKIAETGVKLLWGTANLFSNRRFMGGAATNPDPDVFAYAAATIKANMDVTQRLGG
ENYVLWGGREGYETLLNTNLGQEMDQMARMLSMVVDYKHKIGFTGAILIEPKPQEPTKHQ
YDYDVSTVYGFLKKYGLEDEVKVNIEVGHAILAGHTFEHEVAMAAAHGIFGSIDMNRNDM
QSGWDTDQFPNNVPEVALAYYHILKSGGFTTGGTNFDAKLRRQSIDPEDLLHGHIGGMDT
CARGLKAAAAIIEDGTYDAFLTERYAGWNSAEAQAMLKGERSLSDIAARVEAEGINPQPK
SGRQEYLENLINRFV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattttttcaaaggcctgagcaaggttcggtatgaaggcccaaacagcgacaat
ccgctggccttccatcactataacccggacgaaatcgttatgggtaagcggatggaagag
catttgcgctttgccattgcctattggcattcgtttgcctgggaaggtggcgatccgttt
ggcgggcggaccttcgagcggccgtggttcgatggcggcatggacgccgcgaaactgaag
gccgatgtggcgttcgaattgtttacgctcttgggggcgccctatttctgctttcacgac
gccgatgtgcggcccgaaggcgagagctttgccgagagcaggaagcggctcgaggcgctg
gccgacatttttgagaacaagatcgccgaaacgggcgtgaaactgctctggggcacggcg
aatttgttttccaaccgccggttcatgggcggcgcggcgaccaatcccgacccggacgtg
ttcgcctatgccgccgcgaccatcaaggccaatatggacgtgacccagcggctgggcggc
gagaactatgtgctgtggggcgggcgcgaggggtatgaaaccctattgaacaccaatctg
ggccaggaaatggaccagatggcgcgcatgctctcgatggtggtcgattacaagcacaag
atcgggtttaccggcgccattttgatcgagcccaagccacaggagccgaccaagcaccag
tatgattacgacgtttccaccgtctatggattcttgaagaaatacgggctggaagatgag
gtgaaggtcaatatcgaggtggggcacgccatcctggccgggcacaccttcgagcatgaa
gtggccatggcggcggcgcacgggattttcgggtcgatcgacatgaaccgcaacgacatg
caatcggggtgggacaccgaccagtttcccaacaacgttcccgaagtggcgctggcctat
taccacattctcaaatccggcggatttaccaccgggggcaccaatttcgatgcgaaactg
cgccggcagtcgatcgaccccgaggatttgctgcatgggcatatcggggggatggatacc
tgcgcacgcgggctgaaagcggcggcggcgatcatcgaggacggaacctacgacgcgttc
ctcactgagcggtacgccggctggaacagcgccgaggcgcaggcaatgctcaaaggcgag
cgaagcctttccgatatcgcggcgcgcgttgaagccgaggggatcaatccgcagcccaaa
tcggggcggcaggaatatctggagaacctgatcaacaggttcgtttag

DBGET integrated database retrieval system