KEGG   Pelagibacterium halotolerans: KKY_3489Help
Entry
KKY_3489          CDS       T01645                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
phl  Pelagibacterium halotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KKY_3489
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KKY_3489
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KKY_3489
Enzymes [BR:phl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KKY_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3451220..3452440
Genome map
AA seq 406 aa AA seqDB search
MSQQSANSLRQGPDENGKFGIYGGRFVAETLMPLILDLEKSYRAAQADEKFLAEMDDLRT
HFAGRPSPLYFAERMSAELGGAKIYFKREDLNHTGSHKLNNCIGQILLAKRMGKTRIIAE
TGAGQHGVATATVCARFGLPCTIFMGATDVERQMPNVLRMKMLGAEVRPVTAGAGTLKDA
MNEALRDWVTNVETTYYLIGTAAGPHPYPEMVRDFQKVIGEEIRTQILEAEGRLPDALVA
CIGGGSNAIGTFHDFLDEPNVKIFGTEAGGHGLDVENGHAASMTGGRPGVLHGNRTYLLQ
DADGQILEGHSISAGLDYPGVGPEHSFLRDSGRVNYVPVTDKEALDAFMACTKFEGIIPA
LESAHGLAHVMKLAPDMDRDQIIVLCLSGRGDKDVESVGKHLGMTL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcaaagcgccaattccctgcgtcaggggcccgacgagaacggcaagttcggc
atttatggcggacgcttcgtggccgaaacgctgatgcccttgatcctcgatctggaaaaa
tcctatcgcgccgcccaggccgacgaaaaattcctcgccgaaatggacgatctgcgcacc
catttcgccgggcgtccctccccgctctatttcgccgagcgcatgagcgccgaacttggc
ggcgccaagatctatttcaagcgcgaggacctcaaccacacgggctcccacaagctcaac
aattgcatcggccagattcttctcgccaagcgcatgggcaagacccgcatcatcgccgaa
accggcgccggccagcacggcgtggccacggccaccgtctgcgcccggtttggcctgccc
tgcaccatcttcatgggcgccaccgacgtggagcgccagatgcccaacgtgctgcgcatg
aaaatgctcggcgccgaggttcgccccgtcaccgccggcgccggaacgctgaaagacgcc
atgaacgaggcgctgcgcgattgggtcaccaatgtcgagaccacctattacctgatcggc
accgccgccggcccgcacccctacccggaaatggtgcgcgatttccagaaggtgatcggc
gaggaaatccgcacccagattcttgaggccgaaggccgcctccccgatgcgctcgtcgcc
tgcatcggcggcgggtccaacgccatcggcaccttccacgatttcctcgacgagccgaac
gtgaagattttcggcaccgaggccggcgggcacgggctcgatgtggaaaacggccacgcc
gcctcgatgaccggcggccgccccggcgtgctgcacggcaaccgaacctatctcctccag
gatgccgacggccagatcctcgaaggccattcgatttccgccggcctcgattaccccggt
gtcggccccgaacattccttcctgcgcgacagcggccgggtgaactacgtccccgtcacc
gacaaggaggccctcgacgccttcatggcctgcaccaagttcgaaggcatcatcccggcg
ctcgaaagcgcccacggcctcgcccacgtgatgaaactggcccccgatatggacagggac
cagatcatcgtcctgtgcctttccggccgcggcgacaaggacgtcgaatccgtcggcaag
catctgggcatgacgctttag

DBGET integrated database retrieval system