KEGG   Pelagibacterium halotolerans: KKY_3496Help
Entry
KKY_3496          CDS       T01645                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
phl  Pelagibacterium halotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KKY_3496
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KKY_3496
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KKY_3496
Enzymes [BR:phl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KKY_3496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3455613..3456482
Genome map
AA seq 289 aa AA seqDB search
MGASRIDKRFAKTRAENRPAFVSFVMAGDPDPETADAILAGLPAAGADVIELGMPFSDPM
ADGVAVQLAGQRALAAGMSLEKTLAMVARFREGDDETPIVLMGYYNPIYIYGVEKFIADA
VSSGVDGLIVVDLPAEEDDELCLPAIKAGLNFVRLTTPTTDAHRLPTVLNNASGFVYYVS
MTGITGAEIKNRAAVGEAVNRIKSVTDLPVAVGFGIKSVEDAALIGRDADGVVVGSALVT
AIEKSLENGRASLGTPQAVHNLVRALSQGAFSARVDATLALRERDKTGN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctcgcgcatcgacaagcggtttgcaaagacacgggccgaaaaccgccccgcc
ttcgtctcctttgtcatggcgggcgatcccgatcccgaaaccgccgacgccattctcgcc
gggcttcccgcggcgggcgccgatgtgatcgaactgggcatgcccttttccgatcccatg
gccgatggtgtcgccgtccagctcgccggccagcgcgccctcgccgccggcatgagcctt
gaaaaaacgctggccatggtcgcccgcttccgggaaggggatgatgaaaccccaatcgtt
ctgatgggctactacaatcccatctacatttacggcgtcgaaaagttcatcgccgacgca
gtctcatcgggcgtcgacgggttgatcgtcgtcgacctccccgccgaggaagatgacgaa
ctctgcctccccgcgataaaggccgggctcaatttcgtgcgcctgaccacgcccacgacc
gacgcacaccgcctgcccaccgtgctcaacaatgcctcgggctttgtctattacgtctcg
atgaccggcatcaccggcgccgagatcaagaaccgcgctgcggtgggcgaggcggtcaac
cgcataaaatcggtcaccgatctgcccgttgccgtggggttcggcatcaaatcggtcgag
gacgcggcgctgatcggcagggacgccgatggggtcgttgtcgggtccgcgctggtcacg
gccatcgaaaaatcgctcgaaaacggccgcgccagcctgggcactccacaggctgttcac
aatctggtccgcgctctctcgcaaggagcgttctcagcaagagtggacgccactcttgcg
cttcgagagcgcgacaaaacaggaaattag

DBGET integrated database retrieval system