KEGG   Pelagibacterium halotolerans: KKY_3532Help
Entry
KKY_3532          CDS       T01645                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
phl  Pelagibacterium halotolerans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KKY_3532
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KKY_3532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3499952..3500872)
Genome map
AA seq 306 aa AA seqDB search
MIVVFGSINIDLIGHAPALMRPGETVLGTSLEFSPGGKGGNQALAASRAGADVKMVGCVG
SDDFATRALALLSEAEIDLSGVRHMDRHTGTALIIVDDAGENMITVLPGANSRLTAAALE
QAGIERGDYLLLQLETPLEGVLAAAALARNNGAEIVLNLAPFMDFDPALLDNVDVLVINE
TELAGVLKMLDAPQLDEVDAVSWLSEKFGNTVVATLGARGAIGVAAGEVTVVPSLKIRPV
DTVGAGDTFVGYLAAGLADGIDLASAMDRASVAAGLACLTPGAQPSIPERGAVEDRLTAD
GRPRAR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgttgtgttcggctccatcaatatcgatctgatcggtcacgcgccagcgctgatg
cgaccgggcgaaaccgttctgggcaccagccttgaattttcgcctggcggcaagggtggc
aaccaggcactcgcagcaagtcgggcgggcgctgacgttaaaatggtagggtgcgtgggc
agcgacgatttcgcgacccgtgcgcttgcgctgctgagcgaggccgagatcgacctctcc
ggtgtccgacacatggaccgccacaccggaaccgcgctcatcatcgtcgatgatgccggg
gaaaacatgatcaccgtactgcccggcgccaattcccgcctgacggccgcggcactcgag
caagccggcatcgagaggggagactatctgctgctccagctcgaaacgcccctggaaggc
gtgcttgccgctgcagctctggcgcgaaacaatggcgccgaaatcgttctcaacctggcc
ccgttcatggatttcgacccggcattgctggacaatgtcgatgtgctggtcatcaacgaa
accgagttggccggcgtgctcaaaatgctcgacgctccccagctcgacgaagtcgatgcc
gtgtcctggctctccgaaaaatttggcaataccgtggtggcaacacttggcgcgcgcggt
gccatcggcgtcgccgccggagaggttaccgtcgttccttcgctcaagatcagaccggtc
gatacggtgggggccggcgatacatttgtggggtatcttgccgccgggctggccgacggc
atcgatctcgcatctgcgatggacagggcctcggttgccgcaggactggcgtgtctgaca
cccggtgcccaaccctccattcccgagcgcggggctgtggaagaccggctgacggctgat
gggagaccgagggcccgatga

DBGET integrated database retrieval system