KEGG   Pelagibacterium halotolerans: KKY_3844Help
Entry
KKY_3844          CDS       T01645                                 

Definition
(RefSeq) threonine dehydrogenase
Organism
phl  Pelagibacterium halotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3831443..3832582
Genome map
AA seq 379 aa AA seqDB search
MKAVVYNGPKDVSVNTIDDPKIEKPTDVIIRVTTTNICGSDLHMYDGRTSFEKGRVFGHE
NLGEVIEVGAAVDRIKKGDRVCMPFNVGCGFCENCERGLTAFCLTTNPGTAGAAYGFAEM
GPWQGGQAELMRVPYADFNCLKLPEDAEEKEDDYVMLSDIFPTGWHGVEMSGFLPGESIA
IYGAGPVGLMAAHSAQIRGASQIFVVDSHDDRLKLAEAMGAIPIDMRKGDPAQQILDATG
GRGTDRGVEAVGYQCCDRHGKERSNYTMNCLVKSTKATGGIGVVGVFVPEDPNAPDDLQK
EGKIAFDFGNFWFKGQKIGTGQCNVKHYNRRLMNLIEHGRANPAQIISHRLPLDQAPDAY
KHFDERDGGWTKVLLKPGT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgtcgtgtacaacgggcctaaagatgtttctgtcaataccatcgacgatccc
aagatcgagaaaccgaccgatgtgatcattcgggtgaccaccaccaacatttgcgggtct
gaccttcacatgtacgatggccgtaccagcttcgagaagggcagggtcttcggtcacgaa
aaccttggcgaagtcatcgaggtcggcgctgccgtagatcggatcaagaaaggcgatcgc
gtctgtatgccgttcaacgtgggttgcgggttctgcgaaaattgcgaacgcggtctgacg
gcgttttgcctcacgaccaaccccggaaccgccggcgcagcgtatggctttgccgaaatg
gggccgtggcaaggcggtcaggccgagttgatgcgcgttccttatgcggacttcaattgt
ctgaagctgcccgaggacgctgaggagaaggaggatgactatgtcatgctctccgacatc
ttcccgacgggttggcacggcgtcgaaatgtccggtttcctgcccggcgaaagcatcgcg
atctacggcgctggtccggtcggtttgatggccgcgcactcagcccaaattcgcggtgcc
tctcagatcttcgtggtcgattctcacgatgaccgcttgaaactggccgaggcgatgggc
gcgattccgatcgacatgcgcaagggcgatcccgcccagcagatccttgacgcaaccggc
ggccgcgggaccgaccggggggtcgaggcggtcgggtatcagtgttgcgatcgccacggc
aaggagcgcagcaattacacgatgaactgcctcgtcaaaagcacgaaggccaccggcgga
atcggcgtcgtcggcgtgttcgttccggaagacccgaacgcgcccgacgatcttcagaag
gaaggcaagattgcgttcgacttcggcaacttttggttcaagggccagaagatcggcacc
ggacaatgtaatgtaaagcattataaccggcggctgatgaaccttatcgagcatggccgg
gccaatcctgcccaaatcatctcgcaccggctgccgcttgatcaggcaccagacgcctac
aagcatttcgacgagcgcgatggtggttggacgaaggtcttgctcaagccgggcacctga

DBGET integrated database retrieval system