KEGG   Pelagibacterium halotolerans: KKY_401Help
Entry
KKY_401           CDS       T01645                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
phl  Pelagibacterium halotolerans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KKY_401
  Amino acid metabolism
   00340 Histidine metabolism
    KKY_401
Enzymes [BR:phl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     KKY_401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
392652..393944
Genome map
AA seq 430 aa AA seqDB search
MTALLSSAEPGFAQAFETLLGSKREASVEVSETVAAIIADVRARGDAALIDLTRKFDGLD
LTPQTMRFSSEEIETAYRAVSPQIRDALTLAHKRIASHHEKQKPLDHIYTDDIGVTLGSR
WTPVEAAGLYVPGGLASYPSSVLMNAIPAKVAGVERLAMVVPTPNGVVNPAILAAAKIAG
VTEIYRVGGAQAIAALAFGTETIAPVAKITGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
IIADGSANPAWLAADLLAQAEHGAGAQSILLTTDEALAKAVLAEVDRQLATLRAPDNARR
GWEEFGAIITVGSLDEAMSLANRIASEHVELALDDPHSWIDKIRNAGAIFVGHHTPESIG
DYVGGSNHVLPTARSARFASGLGVLDFVKRTSILGCTPQALAELADATVTLAETEGLEAH
GKSVSIRLNR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacttctttcaagcgctgaaccgggctttgcgcaggccttcgagacgcttctg
ggctccaagcgcgaagcctcggtcgaggtgagtgaaacggtcgccgcgatcattgccgac
gtgcgggcccgaggcgatgccgcgctgatcgatctgacccggaagttcgacgggctggac
ctgactccccaaaccatgcggttctcatccgaagagatcgaaacggcctatcgggcggtt
tcgccgcaaattcgcgacgcgctgacattggcgcacaaacgcatcgcctcccatcacgaa
aagcaaaagcccctcgaccacatctacaccgacgatatcggcgttacgctgggaagccga
tggacaccggtcgaggctgccgggctctacgttccgggcgggctggcatcctatccgtcc
tcggtgctcatgaacgccattccggccaaggtggcaggggtagagcgattggccatggtg
gtgccgacgccgaatggcgtggtcaatcccgccattctcgccgccgcgaaaatcgccggc
gtcaccgaaatctatcgcgtcggcggtgcacaggcgattgcggcactggccttcggcacc
gagacgatcgcacccgtcgccaagatcaccgggccgggcaacgcctatgtggcggctgcc
aagcgccaggtctttggcactgtgggcatcgatatgatcgccggcccctccgaagtgctc
atcattgccgatgggtcggccaatccggcctggcttgctgccgatctcctggcacaagcc
gagcacggggcaggggctcagtcgatcctgctgaccacagacgaagcgctggcgaaggcc
gttcttgccgaagtcgaccggcaattggcgacccttcgtgcacccgacaacgcccgccgg
ggttgggaagaattcggcgcgatcatcacggtcggtagccttgatgaagccatgtctctg
gccaatcgcatcgcttcggagcatgtcgaactcgcgctcgacgacccgcactcgtggatc
gacaaaattcgcaatgccggcgcgattttcgtcgggcaccacacgcccgaatcgattgga
gattacgttggcggctccaatcacgtccttccgacggcgcgttccgcccgatttgcctcg
gggctcggtgttctcgatttcgtcaaacgcacctcgatcctgggctgcacgccccaggct
ctggccgagctcgccgacgcgactgtaacactggcggaaaccgaagggctcgaagcccac
ggaaagtcggtgtcgataaggctaaatcgctga

DBGET integrated database retrieval system