KEGG   Pelagibacterium halotolerans: KKY_412Help
Entry
KKY_412           CDS       T01645                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
phl  Pelagibacterium halotolerans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KKY_412
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KKY_412
Exosome [BR:phl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KKY_412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(400563..402056)
Genome map
AA seq 497 aa AA seqDB search
MGSHILAIDQGTTSSRALVFDKAMKVAGQGQKEFAQHFPQSGWVEHDPEDIWESVISSVR
SALKRARLSADDIAAIGITNQRETTLVWDRKSGKPIHRAIVWQDRRTSDICNALKSAGKE
SLVSQKTGLLLDPYFSGTKIKWLLDSVEGARRRAEAGELAFGTMDTYLIWRLTGGAVHAT
DATNASRTLLFDIEKNAWDDELLALMDVPAAMLPEVRDCDGDFGRTDAAIFGRQIPIRGV
AGDQHAAVIGQACFTPGMIKSTYGTGCFAVLNTGDTQVRSQNRLLTTIAYRLGGKTTYAL
EGSIFVAGAAVQWLRDGLKIIGKASDSGRLALGADPKQSVYLVPAFVGLGAPYWDAEARG
AMFGLTRNTGPEELARAALEAVCYQTADLLDAMHKDWNSRGAATVLRVDGGMVASDYMMQ
FLADILDAPIDRPHMLETTVLGAAWLAGQAIGMWPDQTAFSRSWALEHQFVPEMDEAVRN
EKLAGWHDAVSRTISER
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggagccacattctggccatcgaccagggcacgacgtcgagccgggcgctggttttc
gacaaggctatgaaggttgccggtcagggccagaaggagttcgcgcaacattttccccaa
agtggctgggttgagcacgatcccgaagacatctgggaatcggtgatttcctccgtccgc
tcggcgctgaagcgtgcgaggctttccgcagatgacattgccgccatcgggattaccaac
cagcgggaaaccaccctggtgtgggaccgaaaatccggcaagccgattcaccgggccatt
gtctggcaggatcgccggacatccgatatctgcaatgcactcaaatcggcaggcaaggag
tctttggtcagccagaaaacgggcctgctgctcgacccctatttttccggcaccaagatc
aaatggttgctcgactccgtagagggcgcgcgaaggagggccgaagccggggaactggcc
ttcggaaccatggacacttatctcatctggcggctgacggggggcgccgtccacgcgacc
gacgcgaccaatgccagccgcacactgttgttcgacattgaaaagaacgcctgggacgac
gaattgctggcgctcatggatgtgccggcggccatgttgccggaggttcgcgactgcgac
ggggacttcgggcggaccgatgcagcaattttcggcaggcaaatccctatccgcggcgtg
gccggagatcagcatgcagcggtcatcgggcaggcgtgttttacgcccgggatgatcaag
tcgacctatggcacggggtgttttgcggtgctcaataccggcgatacccaggtgcgctcc
cagaaccggctcctcacgacgatcgcctaccggctgggtggcaagaccacctatgcgctg
gagggctcgatctttgtggcgggcgctgccgtgcagtggttgcgcgatggactcaagatc
atcggcaaggcatcggactccggccgattggcgctcggggccgatccaaagcagagcgtt
tatctggtgccggcgttcgtggggttgggcgccccctattgggatgcggaagcgcggggg
gccatgttcgggcttacgcgcaacaccggacccgaagaactcgcgcgcgcagccctggaa
gccgtttgctaccagaccgccgatcttctcgatgcaatgcacaaggactggaattcccgc
ggggccgcgaccgtgcttcgggtcgatggcggaatggtggcatccgactatatgatgcaa
tttctcgccgatattctcgatgcgccgatcgacaggccccatatgcttgaaaccacggtt
ctgggcgccgcctggcttgccggacaggccatagggatgtggccggaccaaacagccttt
tccaggagttgggcactcgaacaccagttcgtgcccgagatggacgaggcggtgcgcaac
gaaaagcttgcgggctggcatgatgcggtcagccggacgatctcggagcgataa

DBGET integrated database retrieval system