KEGG   Pelagibacterium halotolerans: KKY_47Help
Entry
KKY_47            CDS       T01645                                 

Definition
(GenBank) membrane c-type cytochrome cy
  KO
K08738  cytochrome c
Organism
phl  Pelagibacterium halotolerans
Pathway
phl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KKY_47
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AEQ50095
UniProt: G4RFT1
Position
complement(46513..47664)
Genome map
AA seq 383 aa AA seqDB search
MNSFELNKIFGAILGTLVFVMGVGFIADEIYAPIEGRGASYDLPEPAAEGEAGGEEAPGV
PPIAARMQTASAEAGESLITRCQSCHDYSPANENRTGPGIYGVVGHPIASHEGFAYSDAL
ATLGSNGEIWDYEHLDAFLESPRNYAPGTKMSFAGLSNPEDRANLIAFLRENSDDPFPLP
EAPAEQEAAPAEGDGGEEAPVEDELTAAMAAVTPEDGEALIVRCQSCHDYSPENANRVGP
GIHNVVGADIAHHEGYAYSDALASLGAEGETWSPENLSAFLESPSDFAPGTRMSFPGLAN
IEDRAALIVFLNSISDNPIDLGGGAASAGEAPAEQPAVEEVEQLNLEEAAEGDDPVVVDA
EAPQADPAEGETELDNTPETTAN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatttgaactcaacaagatttttggcgccatcctgggcaccttggtctttgtc
atgggtgtcggcttcatcgctgacgaaatttacgctccgatcgaagggcgtggcgcaagc
tacgatcttccggagccagccgctgaaggcgaagcgggcggcgaagaggcccctggagtg
ccgccgattgcggcccgcatgcagaccgcgtccgcggaagccggtgagagcctgattacg
cgctgccagtcgtgccacgattattccccggcgaacgaaaaccgcaccggaccgggtatc
tatggcgtggtcggtcatcccatcgccagccacgagggttttgcatattccgacgccctg
gctacactcggctcgaacggtgaaatatgggattacgagcatctcgacgcgttccttgaa
agcccgcgcaactatgcgcctggcacaaagatgagctttgccggcctctccaaccccgag
gatcgcgccaatctcatagctttcctgcgcgagaattcggacgatccgttcccgctgccc
gaagctcccgccgagcaagaggccgcccctgccgaaggcgacggcggcgaggaagcgccg
gttgaggacgaactgacggcagcaatggccgccgtgacgccggaagacggcgaagcattg
atcgttcgctgccagtcctgccacgactattcgcccgagaacgcaaaccgcgtcggcccg
ggaattcacaatgtggtcggtgccgatatcgcccatcacgaagggtatgcctattctgat
gcgctggcatcgttgggagccgaaggcgagacctggtcgccggagaacctcagtgctttc
ctcgaaagcccgtccgacttcgcccctggcacgcggatgagctttcccggacttgccaat
atcgaagatcgcgcagcgttgatcgtgttcctcaattcgatctcggacaacccgatcgat
cttggcggcggcgctgcttccgccggcgaagccccagcggaacaacccgctgtcgaggaa
gtcgaacaactcaatctcgaggaagcggccgaaggggacgatccggtggttgtcgatgcc
gaggcaccgcaagccgatcctgcagaaggcgagacggaattggacaacacgccggaaacc
acggccaactga

DBGET integrated database retrieval system