KEGG   Pelagibacterium halotolerans: KKY_47Help
Entry
KKY_47            CDS       T01645                                 

Definition
membrane c-type cytochrome cy
Orthology
K08738  
cytochrome c
Organism
phl  Pelagibacterium halotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    KKY_47
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KKY_47
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46513..47664)
Genome map
AA seq 383 aa AA seqDB search
MNSFELNKIFGAILGTLVFVMGVGFIADEIYAPIEGRGASYDLPEPAAEGEAGGEEAPGV
PPIAARMQTASAEAGESLITRCQSCHDYSPANENRTGPGIYGVVGHPIASHEGFAYSDAL
ATLGSNGEIWDYEHLDAFLESPRNYAPGTKMSFAGLSNPEDRANLIAFLRENSDDPFPLP
EAPAEQEAAPAEGDGGEEAPVEDELTAAMAAVTPEDGEALIVRCQSCHDYSPENANRVGP
GIHNVVGADIAHHEGYAYSDALASLGAEGETWSPENLSAFLESPSDFAPGTRMSFPGLAN
IEDRAALIVFLNSISDNPIDLGGGAASAGEAPAEQPAVEEVEQLNLEEAAEGDDPVVVDA
EAPQADPAEGETELDNTPETTAN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatttgaactcaacaagatttttggcgccatcctgggcaccttggtctttgtc
atgggtgtcggcttcatcgctgacgaaatttacgctccgatcgaagggcgtggcgcaagc
tacgatcttccggagccagccgctgaaggcgaagcgggcggcgaagaggcccctggagtg
ccgccgattgcggcccgcatgcagaccgcgtccgcggaagccggtgagagcctgattacg
cgctgccagtcgtgccacgattattccccggcgaacgaaaaccgcaccggaccgggtatc
tatggcgtggtcggtcatcccatcgccagccacgagggttttgcatattccgacgccctg
gctacactcggctcgaacggtgaaatatgggattacgagcatctcgacgcgttccttgaa
agcccgcgcaactatgcgcctggcacaaagatgagctttgccggcctctccaaccccgag
gatcgcgccaatctcatagctttcctgcgcgagaattcggacgatccgttcccgctgccc
gaagctcccgccgagcaagaggccgcccctgccgaaggcgacggcggcgaggaagcgccg
gttgaggacgaactgacggcagcaatggccgccgtgacgccggaagacggcgaagcattg
atcgttcgctgccagtcctgccacgactattcgcccgagaacgcaaaccgcgtcggcccg
ggaattcacaatgtggtcggtgccgatatcgcccatcacgaagggtatgcctattctgat
gcgctggcatcgttgggagccgaaggcgagacctggtcgccggagaacctcagtgctttc
ctcgaaagcccgtccgacttcgcccctggcacgcggatgagctttcccggacttgccaat
atcgaagatcgcgcagcgttgatcgtgttcctcaattcgatctcggacaacccgatcgat
cttggcggcggcgctgcttccgccggcgaagccccagcggaacaacccgctgtcgaggaa
gtcgaacaactcaatctcgaggaagcggccgaaggggacgatccggtggttgtcgatgcc
gaggcaccgcaagccgatcctgcagaaggcgagacggaattggacaacacgccggaaacc
acggccaactga

DBGET integrated database retrieval system