KEGG   Pelagibacterium halotolerans: KKY_502Help
Entry
KKY_502           CDS       T01645                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
phl  Pelagibacterium halotolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KKY_502
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KKY_502
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KKY_502
Enzymes [BR:phl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KKY_502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489888..491288
Genome map
AA seq 466 aa AA seqDB search
MQYVSTRGQSPALGFCDVVLAGLARDGGLYVPADWPRFTPEEIHNFGNRPYQDVALAVIS
KFVGDEIDQADLKAMIKSAYAGFNHPSVTPLVELEPGHFVLELWHGPTLAFKDVAMQFLA
RVIDHILGQRGERATIVGATSGDTGSAAIEAFRGRQNTDIFILHPKGRTSEIQRRQMTTV
LDDNVFNIALEGTFDDCQAIVKAMFNDFAFRDGAKLSGVNSINWGRIAAQVVYYFTSAVA
LGAPHRKITFVVPTGNFGDIFAGYVAKRMGLPIEKLVIATNSNDILRRAVKFGRYDKRGV
AQTVSPSMDIEVSSNFERLLFEALDRDGDKTAALFASLAQSGGFSIPEPALDTIREEFGT
GMADETATRTIISDVLAHSKYLIDPHTAVGVAVARGFNFGHTPLVTLSTAHPAKFPETVE
AATGRHPELPAHLADLGTREERFTVLANDETVVKDYIRAKTRAWED
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgtcagcacgcgcggccagtcgcccgcgctcggattttgtgacgttgtgctg
gccggactggcgcgggatggcgggctctatgttcctgccgattggccccggttcaccccc
gaggaaatccacaatttcggcaaccgcccctatcaggatgtcgcgctcgccgttatctcc
aaattcgtcggcgatgaaatcgatcaggccgatctcaaggcgatgatcaagtccgcctat
gccgggttcaatcatccatcggttacccccttggttgaactcgaaccgggccacttcgtc
ctcgagctctggcacggcccgacgctggccttcaaagacgttgccatgcagtttctggcg
cgggtaatcgatcacatcctcggtcagcgcggcgagcgcgcgacaattgtcggtgcaacc
tcgggcgataccggttcggcggctatcgaggctttccgcggccgccagaacacagacatc
ttcatccttcaccccaagggccgtacctcggaaatccagcgccgccagatgaccacggtg
ctcgatgacaacgtcttcaacatcgcccttgaaggcacctttgacgattgccaggcaatc
gtcaaagccatgttcaacgattttgccttccgcgatggagcgaaactgagcggtgtcaat
tcgatcaattggggccgcatcgccgcgcaggtggtctattatttcacttccgcggtcgcg
ctcggcgcgccgcaccgcaagatcactttcgtggtcccgacaggcaatttcggcgacata
ttcgccggctatgtcgcaaagcgcatgggtctgcccatcgaaaaactggtgatcgccacc
aattccaacgatattttgcgccgtgccgtaaagttcggtcgctatgacaagcgtggcgtg
gcacagaccgtcagcccctcgatggatatcgaggtgtcatcgaatttcgagcgcctgctt
tttgaggcgctcgatcgcgatggcgacaagaccgcggcgctgtttgcctcgctcgcccag
tcgggtggattttccattcccgaacccgcactcgacacgatccgcgaggaattcgggacg
ggtatggccgatgaaacagccaccaggacgataatttccgacgttctggctcactccaaa
tatctgatcgatccgcatacggccgttggcgtcgcggtcgcgcgcgggttcaatttcggg
catacgccgctcgtcacactttcaaccgcccatccggccaaatttcccgaaacggtcgag
gcggcaaccggccggcaccctgaactgcccgctcacctggccgacctgggaacccgcgag
gagcggttcacggtgctggccaatgacgaaaccgtcgtgaaagactatatccgcgccaag
acacgcgcctgggaggactga

DBGET integrated database retrieval system