KEGG   Pelagibacterium halotolerans: KKY_502Help
Entry
KKY_502           CDS       T01645                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00260  Glycine, serine and threonine metabolism
phl00750  Vitamin B6 metabolism
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01120  Microbial metabolism in diverse environments
phl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KKY_502
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KKY_502
Enzymes [BR:phl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KKY_502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Bcl-2
Motif
Other DBs
NCBI-ProteinID: AEQ50543
UniProt: G4RB34
Position
489888..491288
Genome map
AA seq 466 aa AA seqDB search
MQYVSTRGQSPALGFCDVVLAGLARDGGLYVPADWPRFTPEEIHNFGNRPYQDVALAVIS
KFVGDEIDQADLKAMIKSAYAGFNHPSVTPLVELEPGHFVLELWHGPTLAFKDVAMQFLA
RVIDHILGQRGERATIVGATSGDTGSAAIEAFRGRQNTDIFILHPKGRTSEIQRRQMTTV
LDDNVFNIALEGTFDDCQAIVKAMFNDFAFRDGAKLSGVNSINWGRIAAQVVYYFTSAVA
LGAPHRKITFVVPTGNFGDIFAGYVAKRMGLPIEKLVIATNSNDILRRAVKFGRYDKRGV
AQTVSPSMDIEVSSNFERLLFEALDRDGDKTAALFASLAQSGGFSIPEPALDTIREEFGT
GMADETATRTIISDVLAHSKYLIDPHTAVGVAVARGFNFGHTPLVTLSTAHPAKFPETVE
AATGRHPELPAHLADLGTREERFTVLANDETVVKDYIRAKTRAWED
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgtcagcacgcgcggccagtcgcccgcgctcggattttgtgacgttgtgctg
gccggactggcgcgggatggcgggctctatgttcctgccgattggccccggttcaccccc
gaggaaatccacaatttcggcaaccgcccctatcaggatgtcgcgctcgccgttatctcc
aaattcgtcggcgatgaaatcgatcaggccgatctcaaggcgatgatcaagtccgcctat
gccgggttcaatcatccatcggttacccccttggttgaactcgaaccgggccacttcgtc
ctcgagctctggcacggcccgacgctggccttcaaagacgttgccatgcagtttctggcg
cgggtaatcgatcacatcctcggtcagcgcggcgagcgcgcgacaattgtcggtgcaacc
tcgggcgataccggttcggcggctatcgaggctttccgcggccgccagaacacagacatc
ttcatccttcaccccaagggccgtacctcggaaatccagcgccgccagatgaccacggtg
ctcgatgacaacgtcttcaacatcgcccttgaaggcacctttgacgattgccaggcaatc
gtcaaagccatgttcaacgattttgccttccgcgatggagcgaaactgagcggtgtcaat
tcgatcaattggggccgcatcgccgcgcaggtggtctattatttcacttccgcggtcgcg
ctcggcgcgccgcaccgcaagatcactttcgtggtcccgacaggcaatttcggcgacata
ttcgccggctatgtcgcaaagcgcatgggtctgcccatcgaaaaactggtgatcgccacc
aattccaacgatattttgcgccgtgccgtaaagttcggtcgctatgacaagcgtggcgtg
gcacagaccgtcagcccctcgatggatatcgaggtgtcatcgaatttcgagcgcctgctt
tttgaggcgctcgatcgcgatggcgacaagaccgcggcgctgtttgcctcgctcgcccag
tcgggtggattttccattcccgaacccgcactcgacacgatccgcgaggaattcgggacg
ggtatggccgatgaaacagccaccaggacgataatttccgacgttctggctcactccaaa
tatctgatcgatccgcatacggccgttggcgtcgcggtcgcgcgcgggttcaatttcggg
catacgccgctcgtcacactttcaaccgcccatccggccaaatttcccgaaacggtcgag
gcggcaaccggccggcaccctgaactgcccgctcacctggccgacctgggaacccgcgag
gagcggttcacggtgctggccaatgacgaaaccgtcgtgaaagactatatccgcgccaag
acacgcgcctgggaggactga

DBGET integrated database retrieval system