KEGG   Pelagibacterium halotolerans: KKY_502Help
Entry
KKY_502           CDS       T01645                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
phl  Pelagibacterium halotolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KKY_502
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KKY_502
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KKY_502
Enzymes [BR:phl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KKY_502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489888..491288
Genome map
AA seq 466 aa AA seqDB search
MQYVSTRGQSPALGFCDVVLAGLARDGGLYVPADWPRFTPEEIHNFGNRPYQDVALAVIS
KFVGDEIDQADLKAMIKSAYAGFNHPSVTPLVELEPGHFVLELWHGPTLAFKDVAMQFLA
RVIDHILGQRGERATIVGATSGDTGSAAIEAFRGRQNTDIFILHPKGRTSEIQRRQMTTV
LDDNVFNIALEGTFDDCQAIVKAMFNDFAFRDGAKLSGVNSINWGRIAAQVVYYFTSAVA
LGAPHRKITFVVPTGNFGDIFAGYVAKRMGLPIEKLVIATNSNDILRRAVKFGRYDKRGV
AQTVSPSMDIEVSSNFERLLFEALDRDGDKTAALFASLAQSGGFSIPEPALDTIREEFGT
GMADETATRTIISDVLAHSKYLIDPHTAVGVAVARGFNFGHTPLVTLSTAHPAKFPETVE
AATGRHPELPAHLADLGTREERFTVLANDETVVKDYIRAKTRAWED
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgtcagcacgcgcggccagtcgcccgcgctcggattttgtgacgttgtgctg
gccggactggcgcgggatggcgggctctatgttcctgccgattggccccggttcaccccc
gaggaaatccacaatttcggcaaccgcccctatcaggatgtcgcgctcgccgttatctcc
aaattcgtcggcgatgaaatcgatcaggccgatctcaaggcgatgatcaagtccgcctat
gccgggttcaatcatccatcggttacccccttggttgaactcgaaccgggccacttcgtc
ctcgagctctggcacggcccgacgctggccttcaaagacgttgccatgcagtttctggcg
cgggtaatcgatcacatcctcggtcagcgcggcgagcgcgcgacaattgtcggtgcaacc
tcgggcgataccggttcggcggctatcgaggctttccgcggccgccagaacacagacatc
ttcatccttcaccccaagggccgtacctcggaaatccagcgccgccagatgaccacggtg
ctcgatgacaacgtcttcaacatcgcccttgaaggcacctttgacgattgccaggcaatc
gtcaaagccatgttcaacgattttgccttccgcgatggagcgaaactgagcggtgtcaat
tcgatcaattggggccgcatcgccgcgcaggtggtctattatttcacttccgcggtcgcg
ctcggcgcgccgcaccgcaagatcactttcgtggtcccgacaggcaatttcggcgacata
ttcgccggctatgtcgcaaagcgcatgggtctgcccatcgaaaaactggtgatcgccacc
aattccaacgatattttgcgccgtgccgtaaagttcggtcgctatgacaagcgtggcgtg
gcacagaccgtcagcccctcgatggatatcgaggtgtcatcgaatttcgagcgcctgctt
tttgaggcgctcgatcgcgatggcgacaagaccgcggcgctgtttgcctcgctcgcccag
tcgggtggattttccattcccgaacccgcactcgacacgatccgcgaggaattcgggacg
ggtatggccgatgaaacagccaccaggacgataatttccgacgttctggctcactccaaa
tatctgatcgatccgcatacggccgttggcgtcgcggtcgcgcgcgggttcaatttcggg
catacgccgctcgtcacactttcaaccgcccatccggccaaatttcccgaaacggtcgag
gcggcaaccggccggcaccctgaactgcccgctcacctggccgacctgggaacccgcgag
gagcggttcacggtgctggccaatgacgaaaccgtcgtgaaagactatatccgcgccaag
acacgcgcctgggaggactga

DBGET integrated database retrieval system