KEGG   Pelagibacterium halotolerans: KKY_51Help
Entry
KKY_51            CDS       T01645                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
phl  Pelagibacterium halotolerans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:phl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KKY_51
DNA repair and recombination proteins [BR:phl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KKY_51
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
51056..51658
Genome map
AA seq 200 aa AA seqDB search
MASTSGGPEIEQLIQLLSRLPGLGPRSGRRAVLHLIKKKEQLMIPLAAALDRAVDAVKVC
QTCGNIDTISPCTICADPRRAETGLLIVVEDVADLWALERAGIGMVRYHVLGGVLSPLDG
VGPDDLSIDQLIRRAPDYSEVVLGINATVEGQTTAHYITDRLADTGVAITRLAHGVPVGG
ELDYLDEGTLSQALKARTRF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgtccggtggcccggaaattgagcagctgattcagcttctttcgcgcctg
ccgggtttgggcccacgctcgggccgcagggcggtgctccacctgataaagaaaaaggag
cagttgatgatcccgttggcggcagcgctcgatcgcgcggttgacgcggtcaaggtttgc
cagacctgcggcaatatcgataccatttcgccgtgcacgatctgtgccgacccccgtcgg
gccgaaaccggtctgctcatcgtggtggaagacgtggcggacctctgggctctcgaacgc
gccggaatcggcatggtgcgctatcatgtccttggtggggtcctctcaccgcttgatggt
gttggtccggacgatctttcgatcgatcagctgatccgccgggcccccgactattccgag
gttgttcttgggatcaacgccaccgtcgaggggcagacgacggctcactacatcaccgat
cggcttgcggataccggcgttgccattacccgtttggcgcacggggtgccggtcggtggc
gagctcgattatctcgacgaaggcacgctcagccaggcgcttaaggcccgcacccggttc
tga

DBGET integrated database retrieval system