KEGG   Pelagibacterium halotolerans: KKY_540Help
Entry
KKY_540           CDS       T01645                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
phl  Pelagibacterium halotolerans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:phl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
528200..529069
Genome map
AA seq 289 aa AA seqDB search
MPVTEPAPAKVNLALHVVGRRVDGFHLLHTLCVFTELADLVSAAPARKDMLHVSGPFGAD
LPNGRSNLVIRALEKFRARFPGHLPDGIEIHLEKHLPIAAGLGGGSADAAALLRVLARLC
ETPVADGEIFALAATLGADVPMCLLSQPCEVTGIGENIAPLPAFPHMHLVLVNPLEQIAT
PDVFRRLEHKHNPPMPDLPEPLDRAALLSLWLADTRNDLEAPAIELVPAIASIVDAIATT
SGCVTARMSGSGATCFGLYGSAAAAHQAAHDLRERFSGYWVAATPLLGQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaacagagcccgcgccggccaaggtcaatctcgcgctccacgttgtggggcgc
cgggtggacggatttcacctcctccacaccctttgcgtttttaccgagcttgccgatctg
gtttctgcggcccccgcgcgtaaggatatgctccacgtgtcgggtcccttcggcgccgat
ctgcccaacggacgctcgaaccttgttattcgggccctggaaaaattccgggcccggttc
cccggtcatctgcccgacgggatcgaaatccatctcgaaaagcacctccccattgccgcc
ggacttggcgggggttcggccgatgctgccgcgctgctgcgcgtcctcgcgcgcttgtgc
gaaacgcccgtcgccgatggcgaaattttcgcccttgccgcgacgttgggggccgatgtc
cccatgtgcctcttgagccaaccctgcgaagtaaccggcatcggcgaaaacatcgccccg
cttcccgccttcccccacatgcatctggtcctggtcaatccgctcgagcagattgccacc
cccgatgtattccggcgcctcgagcacaagcacaacccgcccatgccagatcttcctgag
cctctggaccgcgctgcgctcctttcgctctggctggccgacacccgcaacgatcttgaa
gcgcctgccatcgaactcgtgcccgccattgcatcgatagtggacgccatcgccaccaca
tcgggctgcgtcaccgcacgcatgtcgggctcgggcgccacctgtttcggcctctacggt
agcgccgccgccgcccatcaggccgcccacgatctgcgtgagcgcttctcgggctattgg
gtcgccgccacgcctttgctgggacaatag

DBGET integrated database retrieval system