KEGG   Pelagibacterium halotolerans: KKY_540Help
Entry
KKY_540           CDS       T01645                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
phl  Pelagibacterium halotolerans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KKY_540
Enzymes [BR:phl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     KKY_540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
528200..529069
Genome map
AA seq 289 aa AA seqDB search
MPVTEPAPAKVNLALHVVGRRVDGFHLLHTLCVFTELADLVSAAPARKDMLHVSGPFGAD
LPNGRSNLVIRALEKFRARFPGHLPDGIEIHLEKHLPIAAGLGGGSADAAALLRVLARLC
ETPVADGEIFALAATLGADVPMCLLSQPCEVTGIGENIAPLPAFPHMHLVLVNPLEQIAT
PDVFRRLEHKHNPPMPDLPEPLDRAALLSLWLADTRNDLEAPAIELVPAIASIVDAIATT
SGCVTARMSGSGATCFGLYGSAAAAHQAAHDLRERFSGYWVAATPLLGQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaacagagcccgcgccggccaaggtcaatctcgcgctccacgttgtggggcgc
cgggtggacggatttcacctcctccacaccctttgcgtttttaccgagcttgccgatctg
gtttctgcggcccccgcgcgtaaggatatgctccacgtgtcgggtcccttcggcgccgat
ctgcccaacggacgctcgaaccttgttattcgggccctggaaaaattccgggcccggttc
cccggtcatctgcccgacgggatcgaaatccatctcgaaaagcacctccccattgccgcc
ggacttggcgggggttcggccgatgctgccgcgctgctgcgcgtcctcgcgcgcttgtgc
gaaacgcccgtcgccgatggcgaaattttcgcccttgccgcgacgttgggggccgatgtc
cccatgtgcctcttgagccaaccctgcgaagtaaccggcatcggcgaaaacatcgccccg
cttcccgccttcccccacatgcatctggtcctggtcaatccgctcgagcagattgccacc
cccgatgtattccggcgcctcgagcacaagcacaacccgcccatgccagatcttcctgag
cctctggaccgcgctgcgctcctttcgctctggctggccgacacccgcaacgatcttgaa
gcgcctgccatcgaactcgtgcccgccattgcatcgatagtggacgccatcgccaccaca
tcgggctgcgtcaccgcacgcatgtcgggctcgggcgccacctgtttcggcctctacggt
agcgccgccgccgcccatcaggccgcccacgatctgcgtgagcgcttctcgggctattgg
gtcgccgccacgcctttgctgggacaatag

DBGET integrated database retrieval system