KEGG   Pelagibacterium halotolerans: KKY_60Help
Entry
KKY_60            CDS       T01645                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
phl  Pelagibacterium halotolerans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KKY_60
  Amino acid metabolism
   00300 Lysine biosynthesis
    KKY_60
Enzymes [BR:phl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KKY_60
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59368..60537)
Genome map
AA seq 389 aa AA seqDB search
MTHPAVPLLADLIRRPSITPIEDGVLDVLEAFLSPLGFACTRLKFEGDGSYPVDNLYATR
KGKEPGPHLLFAGHTDVVPPGDAAAWTHDPFSGAIVDDVMWGRGATDMKSGVAAFCGALA
QLAQTGGWEKGAVSLAITNDEEADAVNGTKKLMEWAEAQGEKYDFAIVGEPSSFEIFGDS
IKIGRRGSASGKITVIGKQGHAAYPQRANNPMPVIAEIVRALYVPLDNGTEHFQPTNLEV
TSIDTGNPASNVIPERTTLRFNVRFNDTWTGETLLAEIHRRLAEVDTRGCAIAFEQIGPI
SRCFISQPEGHVARLCDVMEAFNGVRPQLSTIGGTSDARFISLYCPVVECGLIGATMHQV
DERVPVADVERLAEFYALYVEKFLSGEPA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcccgccgtcccgctgctcgccgatctgatccgccggccttcgatcaccccg
atagaggacggcgtgctcgacgtgctcgaagcctttctttcaccgctcggctttgcctgc
acgcggctgaagttcgagggcgacggctcctacccggtcgacaacctctacgccacccgc
aagggcaaggaacccggcccgcacctcctgtttgccgggcacaccgacgtcgtccccccc
ggcgatgcggcggcctggacccacgatcccttttccggcgccatcgtcgatgacgtcatg
tggggccgcggcgccaccgatatgaaaagcggcgtcgccgccttttgcggcgccctggcg
cagttggcgcagaccggtgggtgggagaagggcgccgtctcgctcgccatcaccaacgat
gaagaggcagacgccgtcaacggcaccaaaaagctgatggaatgggccgaggcgcaaggc
gagaaatatgatttcgccattgtgggcgagccctcctcgttcgagatcttcggggattcg
atcaagatcggacggcgcggttcggcttcgggcaagattaccgtgatcggcaagcagggg
cacgcggcctatccgcagcgcgccaacaatccgatgccggtcatcgccgaaatcgtgcgg
gcgctctacgtgccgctcgataacggtaccgagcatttccagcccacaaatctcgaagtc
acctccatcgataccggcaatccggcttcaaacgtcatccccgagcgcaccacgctgcgc
ttcaacgtccggttcaacgacacatggacgggcgaaacgctgcttgccgaaatccaccgc
cgtctcgctgaagtcgatacgcgcggctgcgccatcgccttcgagcagatcggcccgatc
tcgcggtgctttatctcccagcccgagggccatgtggcccgtctgtgcgatgtgatggaa
gccttcaacggcgtccgcccgcaactctcgaccatcggcggcacctcggacgcacggttc
atctcgctttattgccctgtggtcgaatgcgggctgatcggggcgaccatgcatcaggtc
gatgaacgcgtgccggttgccgatgtcgagcggttggccgaattctacgcgctttacgtc
gaaaaattcctctccggagaacccgcttga

DBGET integrated database retrieval system