KEGG   Pelagibacterium halotolerans: KKY_693Help
Entry
KKY_693           CDS       T01645                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
phl  Pelagibacterium halotolerans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:phl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:phl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:phl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(668519..669979)
Genome map
AA seq 486 aa AA seqDB search
MSTLSIALCASTALGQDVVQAQSDYFTAGQDLLAERVAAQPNTNQAMNVILFVADGMGIG
TNYGIRVFQGQEMGLLGEEHNLPYDLYPHSAIIKTYNINAQTPDSAPTAGAMNTGVKQVF
NTINMADTVVHNDCSTEAPLTLFSELVSEAGKSVGVVSTARITHATGAAVYAKTANRNWE
NNAPEGCTDIATQLIDQMEAGVIDIALGGGARSFAPEGTELEVGTGNRPDDVNLIDRAAE
IGAQVVYNSEDLAAADLSAPVLGLFTNSDMNYEHDRPEGEPSLADMTTAAIESLQGDEDG
FYLMVEAGRVDHASHGGNAHRAFTDGVALAEAVAAAQEMVDLENTLIIVTADHEHVMSFN
GYCGRGTPITGLCMGVAAGQVEHSGEPVTAADGKPYTVVSYTNGAGSVLIEQEDGTYSGE
RPDLTQEEAQDPDYLQQALIPMGSETHSGVDVGLWANGPWSHLFGGTMDQEMIFHVMNHA
VFGAAE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaccctttccatcgcgctttgcgcatccacagctctcggccaggacgtcgtccag
gcacagagcgattatttcaccgccggccaggatctgctcgccgagcgcgtcgccgcccag
cccaacaccaaccaggccatgaacgtcatcctgttcgtcgccgacggcatgggcatcggc
accaattacggcattcgcgtcttccagggccaggaaatgggccttttgggcgaagagcac
aatctgccctacgacctctatccgcattcggcgatcatcaagacctacaacatcaacgcc
cagaccccggactccgcccccacggcgggcgccatgaacaccggcgtcaagcaggtcttc
aacaccatcaacatggccgataccgtcgtccataacgattgttcgaccgaagcccccctg
accctgttctccgaactcgtttcggaagccggcaagtcggtgggtgtcgtttcgaccgcc
cgcatcacgcacgccaccggcgctgcggtctatgccaagacggccaaccgcaactgggaa
aacaatgctcccgaaggttgcaccgatatcgccacccagctcatcgatcagatggaagcc
ggcgtgatcgacatcgcccttggcggcggcgcgcgctcgtttgcgcccgaaggcaccgag
ctcgaagtcggtaccggcaaccgcccggacgatgtgaacctgattgaccgcgccgccgaa
atcggcgcccaggtggtttacaattccgaagacctcgctgccgccgatctctccgccccg
gtcctcggcctgttcaccaattcggacatgaattacgagcacgaccgccccgaaggcgaa
ccctccctcgccgacatgaccactgctgccatcgaatccctgcagggcgatgaagacggt
ttctacctgatggttgaagccggccgcgtcgatcacgccagccatggcggcaacgcgcat
cgcgccttcaccgacggcgtcgcccttgccgaggccgttgccgcggcccaggaaatggtc
gatctcgagaacacgctcatcatcgtcaccgccgaccacgagcacgtcatgtcgttcaac
ggctattgcggtcgtggcacgccgatcaccggcctttgcatgggcgtggccgccggccag
gtcgaacactccggtgagccggttaccgctgccgatggcaagccctataccgtcgtgtcc
tacaccaacggcgccggttcggtcctgatcgaacaggaagacggcacctattcgggtgag
cgccccgacctgacccaggaagaagctcaggaccccgactacctgcagcaggccctgatc
ccgatgggctcggaaacccactcgggcgtcgatgtcggcctgtgggccaacggtccctgg
tcgcatctgttcggcggcaccatggatcaggaaatgatcttccacgtcatgaaccatgca
gtgttcggcgccgccgagtaa

DBGET integrated database retrieval system