KEGG   Pelagibacterium halotolerans: KKY_731Help
Entry
KKY_731           CDS       T01645                                 

Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
phl  Pelagibacterium halotolerans
Brite
Enzymes [BR:phl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KKY_731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(699669..700595)
Genome map
AA seq 308 aa AA seqDB search
MSDFVSNVSGAFFPVLRQEEGDVLRTYRCPAGFLTIGMGLTKASGVVDPKPGMTITAAQS
LALAQQAIARNYAPRVRKWLPTRKQHVFDGATLFDYNTGRIHNASWVKLLIAGDLKAAQK
SFKQWVRGGGKVLGGLVRRRDVEWQIIEFGIYPAAGARASALSSYVDHAADFKVLGYGLD
KWRSEDAAIRAFQRDHDLTEDGIIGPATRAGLTRAMEARRSGQVSAGSGAAGGAVAGGGE
VSGGADWLDAVSIDTATTMVVTGVAVAAIVFGLTLAWRYRGPLFAWLPEPVKDLTERFGL
TLGRRVRT
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttcgtttccaatgtttcgggcgccttctttcccgtccttcggcaggaggaa
ggcgacgtgctgcgcacctatcggtgtccggccggctttctcaccatcggcatggggttg
accaaggcgtccggggtcgtcgatcccaagccgggcatgaccatcacggccgcgcagagc
cttgccctggcgcaacaggccatcgcccggaattacgcaccgcgtgtgcgcaaatggctt
ccgacccgcaagcagcatgtcttcgacggcgccacgctgttcgattacaacaccggccgc
attcacaatgccagctgggtcaagctgctgatcgcgggtgatttgaaagccgctcaaaag
agcttcaaacagtgggtgcgcggcggcggcaaggtgctcggcgggctggtgcggaggcgc
gatgtcgagtggcagatcatcgaattcggcatctatccggccgccggcgcccgcgcctcg
gccttgtcgagctatgtcgaccatgccgccgacttcaaggtgctgggctatgggttggac
aaatggcggagcgaggatgccgccattcgcgcgttccagcgcgaccatgacctgaccgag
gacgggattatcggcccggccacccgcgcgggcctgacccgcgcgatggaagcccggcgc
tccggccaggtcagcgccggaagtggcgcggccggcggcgccgtagccggtggcggcgag
gtttcgggcggggcggactggctcgacgcggtcagcatcgacacggccaccacgatggtt
gtgaccggtgtggccgtggcggcgatcgttttcgggctgacgctggcctggcggtatcgc
gggccgctctttgcctggttgcccgagccggtcaaggatttgaccgagcggttcggtctc
accctggggcggcgggtgcggacatga

DBGET integrated database retrieval system