KEGG   Pelagibacterium halotolerans: KKY_987Help
Entry
KKY_987           CDS       T01645                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
phl  Pelagibacterium halotolerans
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KKY_987
  Lipid metabolism
   00561 Glycerolipid metabolism
    KKY_987
   00600 Sphingolipid metabolism
    KKY_987
Enzymes [BR:phl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     KKY_987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962635..963984
Genome map
AA seq 449 aa AA seqDB search
MANPKIAFIGAGSTVFMKNIIGDVLQRKPLAGAHIALMDIDPQRLADSELVAGKLVKTLG
APATVTTHTDRRAALDGADFVIVAFQIGGYEPSTVIDFEVPKRFGLRQTIADTLGIGGIM
RGLRTVPHLWAVCADMEELCPNAILLQYVNPMAINTWAIAEKYPAIRQVGLCHSVQGTAA
ELARDLEIPVETLRYRAAGINHMACYLTLEQRQPDGSHKNLYPDLLAGYRAGKIPKPSDW
NPRCPNRVRYEMMTRLGYFVTESSEHFAEYVPWFIKSGRDDLIEKYGIPLDEYPKRCIEQ
VEDWTEQAERYRTAETIEIEESHEYASSIVNAIWTGEPAVIYGNIRNNGAIASLPDSCAV
EVPCLVDANGIQPTHIGALPPQLTALMRTNINVQELTVKALTTENREHIYHAAMLDPHTA
AELDLDQIWSLVDDLIAAHGDMLPAWARR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacccaaaaattgcctttatcggcgccggctcgaccgttttcatgaaaaacatc
atcggcgatgtcctgcaacgcaagccgctggccggtgcccatatcgcgctcatggacatc
gatccccagcgccttgccgatagcgaactggtggcgggaaagctggtcaaaacgctcggc
gctccagcgacagtcaccacccacaccgaccgccgcgctgcattggacggggccgatttc
gtcatcgtcgccttccagatcggcggctatgagccctccaccgtgatcgatttcgaggtg
cccaaacgcttcggcctgcgccagaccatcgccgatacgctggggatcggcggcatcatg
cgcggcctgcgcacggtcccccatctctgggcggtctgcgccgatatggaagagctgtgc
cccaacgccatcttgctccaatacgtcaaccccatggccatcaacacctgggccatcgct
gaaaaataccccgccatccgccaggtcggtctctgccactcggtgcagggcacagccgca
gaactggcgcgcgacctcgaaattcccgtcgaaacgctgcgctacagggcggccggcatc
aatcacatggcgtgctatctgaccctcgaacagcgccagcccgacggcagccacaagaac
ctctacccggacctcctcgcaggctatcgtgccggcaaaatcccaaagcccagcgactgg
aacccgcgctgtccaaacagggtgcgctatgaaatgatgacccggctgggctatttcgtc
accgaaagctccgagcacttcgccgaatacgtgccctggttcatcaaatcgggccgcgac
gacctgatcgaaaaatacggcattccgctcgatgaataccccaagcgctgcatcgagcag
gtcgaggactggacagagcaggcagaacgctaccgtaccgccgaaaccatcgagatcgag
gaaagccacgaatacgcctcctccatcgtcaacgccatctggacgggcgagcccgcggtc
atctacggcaatatccgcaacaatggcgccatcgcctcgctgcccgattcctgcgcggtc
gaagtgccctgtctcgtcgatgccaacggcatccagcccacccatatcggcgcgttgccg
ccgcaactgaccgccctgatgcgcacaaacatcaacgtgcaggaactcacggtcaaagcg
ctcaccaccgagaaccgcgagcacatctaccacgccgccatgctcgacccccacaccgcc
gccgaactcgatctcgaccagatctggtcgctggtcgatgacctcatcgccgcccatggc
gatatgctaccggcatgggcacggcgctga

DBGET integrated database retrieval system