KEGG   Phycisphaera mikurensis: PSMK_01090Help
Entry
PSMK_01090        CDS       T01800                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSMK_01090 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSMK_01090 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSMK_01090 (thrC)
Enzymes [BR:phm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSMK_01090 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114393..115817
Genome map
AA seq 474 aa AA seqDB search
MRYVSTRGEAAELEFEDVLLEGLARDGGLYVPDAWPTLGEARRRELATRPYARVAAEVMW
PFLSGNLERATFEGIVDAAYAGFRHEAVAPLVQLAPNLWVMELFHGPTLAFKDVAMQVLG
RLFDHVLAARGDRMTIVGATSGDTGSAAIEAFRDRENCDIFILHPRGRTSDVQRKQMTTV
NAANVHNVAIEGTFDDCQDLVKAMFNDAAFRDGVRMSGVNSINWARVMPQSVYYVTAAAQ
LGCFTDRRPVRFSVPTGNFGDVYAGYIAARMGVPASRLVVASNRNDILTRVLRDGDHSRG
EVHATVSPSMDIQSSSNFERLLLDMEAGDTAKVARLMKQWKQTGAFTVDATARARLAGRF
TGHRVDEEKTLDTIRSVYADTGYLLDPHTAVGHAAALAEAAPEHAEFGGIALPTVVLATA
HPAKFPDAVEKACGVRPPLPGFLADLYEREERFDTLENELSVVQAYIRERTRAA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacgtgtccacccggggcgaagccgccgagctcgagtttgaggacgtgctgctc
gaggggctcgcgcgggacggcgggctctacgtgcccgacgcgtggccgacgctgggcgag
gcccgccggcgcgagctcgcgacgcggccctacgcacgcgtcgccgccgaggtcatgtgg
cccttcctctcgggcaacctcgagcgggccaccttcgagggcatcgtcgatgcggcctat
gccggcttccggcacgaagccgtcgcgccgctggtgcagctggccccgaacctctgggtg
atggagctgttccacgggccgacgctggcgttcaaggacgtcgcgatgcaggtgctcggc
cggctcttcgatcacgtcctcgcggcgcgcggcgaccggatgacgatcgtcggcgcgacc
tcgggcgacaccggctcggcggccatcgaggccttccgcgaccgcgagaactgcgacatc
ttcatcctgcaccccagggggcggaccagcgacgtccagcgcaagcagatgacgacggtg
aacgccgcgaacgtgcacaacgttgcgatcgagggcaccttcgacgactgccaggacctc
gtgaaagcgatgttcaacgacgcggccttccgcgacggcgtgcggatgagcggcgtcaac
agcatcaactgggcccgggtgatgccccagtcggtctactacgtgaccgccgcggcgcag
ctgggctgcttcaccgaccgccggccggtccgcttcagcgtgcccacgggcaacttcggc
gacgtgtacgcgggctacatcgcggcgcggatgggcgtgccggccagccgcctggtcgtc
gcgagcaaccgcaacgacatcctcacccgcgtgctgcgcgacggcgaccactcccgcggc
gaggtccacgcgacggtgagcccgtcgatggacatccagtccagcagcaacttcgagcgg
ctgctgctggacatggaagccggcgacaccgcgaaggtcgcccggctgatgaagcagtgg
aagcagaccggcgccttcacggtcgacgcgacggcccgggcccgcctcgccggccgcttc
accggccaccgcgtggacgaggagaagaccctcgacacgatccggagcgtctacgccgac
accggctatctgctcgacccccacacggccgtcggccacgcggcggccctcgccgaggcc
gcgcccgagcacgcggagttcggcggcatcgcgctgccgacggtcgtgctcgcgacggcc
caccccgcgaagtttcccgacgcggtggaaaaagcctgcggtgtgcggccgccgctgccg
ggcttcctcgcggacctgtacgaacgggaggagcggttcgacacgctggagaacgagcta
tccgtggttcaggcgtacatccgggagaggacgcgggcggcttag

DBGET integrated database retrieval system