KEGG   Phycisphaera mikurensis: PSMK_02000Help
Entry
PSMK_02000        CDS       T01800                                 

Definition
putative alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
phm  Phycisphaera mikurensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:phm00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:phm00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:phm00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(218218..219660)
Genome map
AA seq 480 aa AA seqDB search
MPRPVHLTFLGAGSNFCSTLCRDLLLIPGNAGGELRLVDVDRGRLDRMHRVIEKLIEATG
NADKWKVVSSTDRRAVLPGTHYAVCCVEVSGVDCVAWDNDIPLKHGIDQCIGDTLGPGGL
FKALRTVPVFLDALRDMRELCPGALMLNYTNPMGILCLAAGRAVPEVPVVGLCHSVQGTS
HLLAEYAGVDYETLRWECAGINHLAWFTKLERNGEDLYAKTLRAKFEAEVAAGFAEAEAG
VAVHDAQDAVFGEEKEQPYEGRDLVRKDMCLQFGAFITESSGHLSEYLPWYRKNERGRAL
LRRGYDGGSRFYATNWPHWRTEADALRDRLVSGEEQIDLKRSWEYGTFIIEAIEKDAPWR
IHGNVMNRVADPAKASPGEAGKLITNLPGDGCVEVACLVDGNGVQPTRYGALPAPMARVC
ASNMAFIDLAATAVIQRSKEAAVHALLLDPLTAAVLSPAQIREMAMEMFEAEKDFLPGYA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccccggcccgtccacctcaccttcctgggcgccggctcgaacttctgctccacgctg
tgccgcgacctgctgctcatccccggcaacgccggcggcgagctgcgcctcgtcgacgtc
gaccgcggacgcctcgaccgcatgcaccgggtcatcgagaagctcatcgaggcgacgggc
aacgccgacaagtggaaggtggtctcctccaccgaccgccgcgcggtgctccccggcacg
cactacgccgtgtgctgcgtcgaggtctccggcgtcgactgcgtcgcctgggacaacgac
atcccgctcaagcacggcatcgaccagtgcatcggcgacacgctgggccccggcggcctc
ttcaaggcgctccgcacggtccccgtgttcctcgacgccctccgcgacatgcgcgagctg
tgccccggggcgttgatgctcaactacaccaacccgatgggcattctgtgcctcgccgcg
ggtcgggccgtgcccgaggtccccgtcgtgggcctgtgccacagcgtgcagggcaccagc
cacctgctggccgagtacgccggcgtcgactacgagacgctccgctgggagtgcgccggc
atcaaccacctggcgtggttcaccaagctcgagcgaaacggcgaggacctctacgcgaag
accctccgggcgaagttcgaggccgaggtcgccgccggcttcgccgaagccgaggccggc
gtcgccgtgcacgacgcccaggacgccgtcttcggcgaggagaaggagcagccctacgag
ggccgcgatctggtccgcaaggacatgtgcctgcagttcggcgccttcatcaccgagagc
tcgggccacctctccgagtacctgccgtggtaccgcaagaacgagcgcggccgggcgctg
ctccgccgcggctacgacggcggctcccgcttctacgcgaccaactggccccactggcgg
accgaagccgacgcgctccgcgaccggctggtgagcggcgaggagcagatcgacctgaag
cggagctgggagtacggcaccttcatcatcgaggcgatcgagaaggacgcgccgtggcgg
atccacgggaacgtgatgaaccgggtggccgatccggccaaggcttcgcctggggaggcc
ggcaagctcatcaccaacctccccggcgacggctgcgtcgaggtcgcctgcctcgtcgac
ggcaacggggtgcagccgacccgctacggcgccctgccggcgccgatggcccgcgtctgc
gcgagcaacatggccttcatcgacctcgccgcgacggcggtcatccagcggagcaaggag
gccgccgtgcacgccctgctgctcgacccgctgaccgccgcggtgctgtcgccggcccag
atccgggagatggcgatggagatgttcgaggccgagaaggacttcctgcccggctacgcg
tga

DBGET integrated database retrieval system