KEGG   Phycisphaera mikurensis: PSMK_02050Help
Entry
PSMK_02050        CDS       T01800                                 

Definition
putative glycogen/starch synthase (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
phm  Phycisphaera mikurensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSMK_02050
Enzymes [BR:phm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PSMK_02050
Glycosyltransferases [BR:phm01003]
 Polysaccharide
  Storage polysaccharide
   PSMK_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(224488..226461)
Genome map
AA seq 657 aa AA seqDB search
MPVRRGDRPANVHERTGNALRSATARQPLLVEAAWEACNPIGGIYTVLRTKVQTMQTKWG
NRYCLAGPYDQVHALREFESDEGASPFRPAVEAMRAAGYRVELGRWLVAGRPWIVLLHRS
DAQRYLGDVKARLWRDHQIPTPDDELIDGVVAFGECLRVFLSFLTQSGATAEQPLAPEEA
DAARAAGEHGAGPGDHEASPSGRAVVAQIHEWMAAPCIPMLRQESWPGTFVFTTHATVLG
RYLAMNDPTFYDHLPFYDAGAEATKFNVASQHGIERAAAHGSQVFTTVSDITALECRHLL
GRDVDHVLPNGINTERFAAIHQFQHLHDEYKNRIHEFTIGHFFPSYTFDLDKTLYLFTSG
RYEYRNKGMDLTIEALARLNHRLKAEGSGVTVVFFLITRAATRSISVASLKGCSYVDDFR
RTIARYERQIAERLFMEATRGGTTDLNTLVDDYSKLRLRRLQQEWKRSGLPSVVTHDLVD
PGRDPVLDQLHRCHLHNAQEDPVKVVFHPDFISGTSPLFGMDYDQFVRGCHLGVFPSYYE
PWGYTPLESIALGVPAITSDLAGFGSYVAQHMPAQRHGGAEGGTAGVPEGVSIVPRRGTD
PNHSAEVLTEEMLRFCRLDRRGRITQRNAVEDFAQDFDWRQLAAHYEEAYATAIERL
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtccgccgcggcgaccggcccgcgaacgtccacgagcggaccggcaacgccctc
cgcagcgcgacggcccgccagccgctgctggtcgaggcggcgtgggaggcgtgcaacccc
atcggcggcatctacaccgtgctgcgcacgaaggtgcagacgatgcagaccaagtggggc
aaccgctactgcctcgccgggccctacgaccaggtccacgcgctgcgggagttcgagagc
gacgagggggccagccccttccggcccgcggtggaggcgatgcgggccgcgggctaccgc
gtcgagctcggccgctggctggtcgcgggccggccctggatcgtgctgctgcaccgcagc
gacgcccagcggtacctcggcgacgtcaaggcccggctctggcgcgaccaccagatcccc
acgcccgacgacgagctcatcgacggcgtcgtcgccttcggcgagtgcctgcgcgtgttc
ctgagcttcctcacgcagagcggtgccacggccgagcagccgctcgcccccgaggaggcc
gacgccgcccgcgccgccggcgagcacggggcgggccccggcgaccacgaagcgtcgccc
tcgggccgcgccgtggtcgcccagatccacgagtggatggccgcgccgtgcatccccatg
ctccgccaggagagctggccgggcaccttcgtgttcaccacgcacgcgacggtgctcggc
cgctacctggcgatgaacgacccgacgttctacgaccacctgcccttctacgacgcgggg
gccgaggcgacgaagttcaacgtcgccagccagcacggcatcgagcgcgcggccgcccac
ggctcgcaggtcttcacgaccgtcagcgacatcaccgcgctggagtgccgccacctgctc
ggccgcgacgtcgaccacgtgctccccaacggcatcaacaccgagcgtttcgcggccatc
caccagttccagcacctccacgacgagtacaagaaccggatccacgagttcacgatcggg
cacttcttcccgagctacaccttcgacctcgacaagacgctctacctcttcaccagcggc
cgctacgagtaccgcaacaaggggatggacctgacgatcgaggccctcgcccggctcaac
caccgcctcaaagccgaggggagcggcgtcaccgtggtcttcttcctgatcacccgggcg
gccacgcggtcgatctcggtcgcctcgctgaagggctgctcctacgtcgacgacttccgg
cgcacgatcgcgcgctacgagcggcagatcgccgagcggctgttcatggaggcgacccgg
ggcggcacgaccgacctgaacacgctcgtcgacgactactccaaattgcggctgcggcgg
ctgcagcaggagtggaagcgcagcggcctgccctcggtggtgacccacgacctggtcgac
cccggccgcgacccggtgctcgaccagctgcaccgctgccacctccacaacgcgcaggag
gacccggtcaaggtggtcttccaccccgacttcatcagcggcaccagcccgctcttcggg
atggactacgaccagttcgtccgcggctgccacctcggcgtgttccccagctactacgag
ccctgggggtacacgccgctggagtcgatcgccctgggcgtgcccgcgatcaccagcgac
ctcgccggcttcggcagctacgtcgcccagcacatgcccgcccagcggcacggcggcgcc
gagggcggcaccgccggcgtgcccgagggcgtgtcgatcgtgccacgccgcggcaccgac
cccaaccactccgccgaggtcctcaccgaggagatgctgcggttctgccgcctcgaccgc
cgcggccgcatcacccagcgcaacgccgtcgaggacttcgcccaggacttcgactggaga
cagctcgcggcgcactacgaagaggcctacgcgacggcgatcgagcggctctga

DBGET integrated database retrieval system