KEGG   Phycisphaera mikurensis: PSMK_03290Help
Entry
PSMK_03290        CDS       T01800                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
phm  Phycisphaera mikurensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:phm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(362963..363850)
Genome map
AA seq 295 aa AA seqDB search
MSDLPHGPPPPFRLMGILNATPDSFSDGGRFADAEAAVAAGLKMAGEGATILDVGGESTR
PGAERVPAGEQIRRVVPVIRGLAEALPRGGPSVTISVDTTRAAVAEAAADAGATLLNDVS
AGEDDPAMFGVAAERKLPMVLMHKRGEPAVMQRKPAYADVAAEVADHLRARAAAALAAGV
REVWLDPGIGFGKTLAHNLTLLAALPRLVAEGHPVLLGASRKSFLAPLDPSAVSPDGRLP
GSLAVAVLGLAAGVGVFRVHDVAAHRQALATAAAVAEAATQAGTGHRGTPPPNRI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcccgcacggcccgccgccgcccttccggctgatgggcatcctcaacgcg
acgccggacagcttctccgacggcgggcgcttcgccgatgcggaggccgccgtcgccgcc
ggcctgaagatggccggggagggcgccacgatcctggacgtcggcggggagtcgacgcgg
cccggtgccgagcgggtgcccgcgggcgagcagatccgccgcgtggtgcccgtgatccgc
gggctcgccgaggcgctgccacgcggcgggccgtcggtcacgatcagcgtcgacaccacc
cgcgccgccgtcgccgaggccgccgcggacgccggggccacgctgctcaacgacgtctcc
gcgggcgaggacgacccggcgatgttcggggtcgccgcggagcggaaactcccgatggtg
ctcatgcacaagcgtggggagcccgcggtgatgcagcggaagcccgcatacgcggacgtc
gccgccgaggtcgcggaccacctgcgggcccgggccgccgcggcgctggccgccggcgtg
cgggaggtctggctcgacccgggcatcggcttcgggaagacgctcgcccacaacctcacc
ctcctcgccgcgctgccccgcctcgtcgccgagggccacccggtgctgctgggagcgagc
cgcaagagcttcctggccccgctcgacccgtcggcggtctcgccggacggccgcctgccc
ggctccctcgcggtcgccgtgctcgggctggccgcgggcgtcggggtgttccgcgtgcac
gacgtcgccgcccaccgccaggcgctcgccaccgcggccgccgtggcggaagcggccacg
caggcaggaacaggccatcggggaacaccccccccaaacagaatctga

DBGET integrated database retrieval system